Protein Info for DVU1823 in Desulfovibrio vulgaris Hildenborough JW710

Name: gltB-1
Annotation: glutamate synthase, iron-sulfur cluster-binding subunit, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12838: Fer4_7
  • amino acids 21 to 67 (47 residues), 35.2 bits, 6.9e-12
• PF00037: Fer4
  • amino acids 47 to 69 (23 residues), 26.7 bits, see alignment (E = 1.9e-09)
• PF01645: Glu_synthase
  • amino acids 112 to 474 (363 residues), 461.6 bits, E=1.1e-141
• PF00478: IMPDH
  • amino acids 298 to 411 (114 residues), 30.5 bits, E=1e-10
• PF04898: Glu_syn_central
  • amino acids 326 to 483 (158 residues), 30.1 bits, E=1.6e-10
• PF01070: FMN_dh
  • amino acids 378 to 418 (41 residues), 28 bits, 5.8e-10

Best Hits

Swiss-Prot: 65% identical to AGLUS_ARCFU: Archaeal glutamate synthase [NADPH] (gltB) from Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1337)

Predicted SEED Role

"Glutamate synthase [NADPH] large chain (EC 1.4.1.13)" in subsystem Ammonia assimilation or Glutamine, Glutamate, Aspartate and Asparagine Biosynthesis (EC 1.4.1.13)

MetaCyc Pathways

• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamine degradation II (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Glutamate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.4.1.13

Use Curated BLAST to search for 1.4.1.13

Sequence Analysis Tools

See Q72B16 at UniProt or InterPro

Protein Sequence (507 amino acids)

>DVU1823 glutamate synthase, iron-sulfur cluster-binding subunit, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MRSKPISQHFNDFVVERERARCIDCEVCVRQCSYGVHFWDEARKRVEHDSSKCVGCHRCA
AMCPTDCLTIRRKPSDFRENALWTPAFIKNIYKQSDTGGVLLSGMGCPSPKPVYWDNMLL
DASQVTNPSIDPLREPMELRTFLGGRPDRLVFEETPQGPKLQTEIGPQLQLEYPIMFAAM
SFGAINYNLHEAMAKAATELGTFYNTGEGGLHPDLYPYGANTIVQVASGRFGVHKDYLNA
GSAVEIKVGQGAKPGIGGHLPGEKIDEEVSRTRMVPKGSDAISPAPHHDIYSIEDLLQLI
CAIKEATQYRVPVSVKIAAVHNAPAIASGIVRAGADIVVIDGFRGGTGAAPTMIRDNVGI
PIELALAAVDDRLRDEGIRNRASIVAAGGVRCSADVVKAIALGADAVYIGTAALIAVGCT
LCGRCYTGKCPWGIATNESRLKKRQNPDEAARRLTNLVRAWGHEIQEMLGGMGLNSIESL
RGNRDKLRGIGLGDTELDILGIKHAGR