Protein Info for DVU1822 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: glutamate synthase, amidotransferase subunit, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 transmembrane" amino acids 285 to 303 (19 residues), see Phobius details PF00310: GATase_2" amino acids 148 to 336 (189 residues), 39.9 bits, see alignment E=3.5e-14 PF13522: GATase_6" amino acids 182 to 259 (78 residues), 30.9 bits, see alignment E=3.7e-11

Best Hits

Swiss-Prot: 56% identical to Y398_THEMA: Uncharacterized protein TM_0398 (TM_0398) from Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099)

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1822)

Predicted SEED Role

"Glutamine amidotransferase, class-II" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B17 at UniProt or InterPro

Protein Sequence (364 amino acids)

>DVU1822 glutamate synthase, amidotransferase subunit, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKAPKDFWKFDKDIAGCGVFGVIDRKRNLIPGTMPIDAMCTMHDRGNGLGGGFAAYGIYP
DRADDYAFHIMGDDAAALERAETYLAGLFDVHHAEPIPTRDVLTVKNPPLVRRYFLAPKA
VRPQWQHMGESDYVVGAVMHVNTRIPGAFVFSSGKNMGTFKGVGYPEDIADFFRLDEYRA
YMWTAHNRFPTNTPGWWGGAHPFTLLDWAIVHNGEISSYGINRRYLCEHDYECTLMTDTE
VVAYLLDLMVRKHGLSKRMASWVFAPPFWDEVDRMPEEQRKAFTALRAVYGAALLNGPFA
ILVTDSRGMMGLNDRVKLRPLVVAEKDTMTFMSSEESSIREVCRDLDRVWAPKAGEPVIV
ELEA