Protein Info for DVU1821 in Desulfovibrio vulgaris Hildenborough JW710

Name: gltB
Annotation: glutamate synthase, large subunit (VIMSS_AUTO)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 251 PF01493: GXGXG" amino acids 33 to 185 (153 residues), 118.3 bits, see alignment E=1.6e-38

Best Hits

Swiss-Prot: 50% identical to Y1350_METJA: Uncharacterized protein MJ1350 (MJ1350) from Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440)

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1339)

Predicted SEED Role

"Glutamate synthase, alpha subunit domain protein" in subsystem Ammonia assimilation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B18 at UniProt or InterPro

Protein Sequence (251 amino acids)

>DVU1821 glutamate synthase, large subunit (VIMSS_AUTO) (Desulfovibrio vulgaris Hildenborough JW710)
MADRIIIDADGMPYRELNVRIREAVAAGTQVIDLHGVRGQRFIGNAVEGDVSINILGVPG
QDLGAFMRGPHIRVQGNAQDGVGNTMDGGHIVIDGMAGDVLGYAMRDGSILVRGDVGYRV
GIHMKSYLDRVPVIVVGGKAGDFLGEYMAGGVIVLLGMDTGKPEAPVAGRSLGTGMHGGV
IYIRGEVPEHLLGPGLALSPLDEEDGAALARHVQAYADAFGKDAAEILGASFVKVHPRSH
RPYGNMYVGTN