Protein Info for DVU1813 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 25 50 75 97 transmembrane" amino acids 12 to 35 (24 residues), see Phobius details amino acids 41 to 63 (23 residues), see Phobius details amino acids 71 to 95 (25 residues), see Phobius details TIGR02229: caa(3)-type oxidase, subunit IV" amino acids 9 to 97 (89 residues), 92.5 bits, see alignment E=1.1e-30 PF03626: COX4_pro" amino acids 19 to 87 (69 residues), 56.7 bits, see alignment E=1.3e-19

Best Hits

KEGG orthology group: K02277, cytochrome c oxidase subunit IV [EC: 1.9.3.1] (inferred from 99% identity to dvl:Dvul_1347)

Predicted SEED Role

"Cytochrome c oxidase polypeptide IV(EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B25 at UniProt or InterPro

Protein Sequence (97 amino acids)

>DVU1813 hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGSGHDDAHHIISYGTNTLIWCLLLLLTALTVYVASLDFGFLNVVVALTVATTKAGLVVL
YFMHLRYEGWLLRSLVFLAFFILAIAIGFTFFDLAYR