Protein Info for DVU1811 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: protoheme IX farnesyltransferase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 287 transmembrane" amino acids 13 to 51 (39 residues), see Phobius details amino acids 93 to 122 (30 residues), see Phobius details amino acids 133 to 154 (22 residues), see Phobius details amino acids 160 to 181 (22 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 234 to 254 (21 residues), see Phobius details amino acids 261 to 282 (22 residues), see Phobius details PF01040: UbiA" amino acids 24 to 258 (235 residues), 126.2 bits, see alignment E=7e-41

Best Hits

Swiss-Prot: 100% identical to COXX_DESVH: Protoheme IX farnesyltransferase (ctaB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02301, protoheme IX farnesyltransferase [EC: 2.5.1.-] (inferred from 100% identity to dvu:DVU1811)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.5.1.-

Use Curated BLAST to search for 2.5.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B27 at UniProt or InterPro

Protein Sequence (287 amino acids)

>DVU1811 protoheme IX farnesyltransferase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGRCTIADVAMLIRWRVSLMVAGATFFGAMLAVPHVTITHLLASLATFLLAGGCSAINQV
QEADLDAVIPRTASRPIPCGRIGHMYGSLMGLALVTVGWMVLCLAGGLTSLLVGIGIVAV
YNGLYTPLKRRTSFALLVGAAAGAMPPVVGWLAVGGHPASPMLVVVYTLYLLWQIPHFWL
HAARDREAYRKARLPLPLLSLPHERYARLLKVWFHAYAVAVLMVPAFPLLEWVGMRIMVT
LCGIALLFAAMLAVRKRRVALHIADAVLCAVMVVLLIDRLAIPVSLF