Protein Info for DVU1809 in Desulfovibrio vulgaris Hildenborough JW710

Name: nadB
Annotation: L-aspartate oxidase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 528 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details PF07992: Pyr_redox_2" amino acids 9 to 212 (204 residues), 28.4 bits, see alignment E=3.5e-10 TIGR00551: L-aspartate oxidase" amino acids 9 to 528 (520 residues), 487.5 bits, see alignment E=2.2e-150 PF01134: GIDA" amino acids 10 to 38 (29 residues), 23.6 bits, see alignment (E = 7.6e-09) PF00890: FAD_binding_2" amino acids 10 to 397 (388 residues), 278.2 bits, see alignment E=4.5e-86 PF02910: Succ_DH_flav_C" amino acids 452 to 528 (77 residues), 20.9 bits, see alignment E=8.9e-08

Best Hits

KEGG orthology group: K00278, L-aspartate oxidase [EC: 1.4.3.16] (inferred from 100% identity to dvu:DVU1809)

Predicted SEED Role

"L-aspartate oxidase (EC 1.4.3.16)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 1.4.3.16)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.3.16

Use Curated BLAST to search for 1.4.3.16

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B29 at UniProt or InterPro

Protein Sequence (528 amino acids)

>DVU1809 L-aspartate oxidase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSTNRFHTPVLVIGSGIAGCTAALTLADLGAEVTLISTGTRLDTGNSPLAQGGIVFKAVD
GDPRLLEHDIMVAGHHINYRRAVRQISVKGPQAVQGILVDRLGIPFARSGKPQCEWDLTM
EGGHAAHRIMHCADYTGRAIMDGLIAAIEEAPNVRVLSGRTAVDLLTTHHQARSNEFRYQ
INNQCVGAYVLNEHTRSVETMLADVTVLATGGVGQVYLHTTNSPNAIGSGVSMAQRAGVR
IENAEFVQFHPTALFHRSQRRFLISEALRGEGGRLVNGSGEAFMHNYDRRGDLAPRDIVA
RAIVEEMLRTGEDCVYLDASQVEQDLEQRFPTIYQHCQDMGIDIRVEPIPVVPAAHYFCG
GILTDLTGRTTLDRLYAVGECACTGVHGANRLASTSLLEALLWGRTAGEDIARRLHRQRP
MSKRLHAAIPDWQPLGDERNDDPALVAQDWATIRHTMWNYVGITRSTGRLRRAFEDLRDL
SRHLHDFYKRTTLSKPLVDLFHGCHTAYTITQAALRNRQSLGCHYRID