Protein Info for DVU1808 in Desulfovibrio vulgaris Hildenborough JW710

Name: nadA
Annotation: quinolinate synthetase complex, subunit A (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 PF02445: NadA" amino acids 21 to 355 (335 residues), 286 bits, see alignment E=1.6e-89

Best Hits

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 100% identity to dvu:DVU1808)

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B30 at UniProt or InterPro

Protein Sequence (358 amino acids)

>DVU1808 quinolinate synthetase complex, subunit A (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTLHRPTPASSGETPQDVARRIDALRGQLGDDVLVMGHHYQHDSVIRHTDLRGDSLELAR
KVDAISAKHIVFCGVYFMAESAALLARDGQSVHIPESDANCVMSQMAPAQRVDAVLRNLS
GTGRNVIPLAYVNTSLAVKAVVGRHGGAVCTSANAKTMLTWARERADAVVFLPDKNLARN
TADLLGIAEDRRHILDIRDGGAAVDMDAASGAELLMWPGCCAIHARFNLRQMERMRDEHP
GCRIAVHPECSPEVVRAADAAGSTSFLIRYAEEQKPGTTLVIGTEINLVERLAAQHAGRI
TVLPLLESGCSHMARVTAPKLLATLESIASGTASPVAIPLDLQDDAHAALQRMLEACA