Protein Info for DVU1808 in Desulfovibrio vulgaris Hildenborough JW710

Name: nadA
Annotation: quinolinate synthetase complex, subunit A (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02445: NadA
  • amino acids 22 to 355 (334 residues), 278.6 bits, E=2.9e-87

Best Hits

KEGG orthology group: K03517, quinolinate synthase [EC: 2.5.1.72] (inferred from 100% identity to dvu:DVU1808)

Predicted SEED Role

"Quinolinate synthetase (EC 2.5.1.72)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation (EC 2.5.1.72)

MetaCyc Pathways

• aspartate superpathway (20/25 steps found)
• NAD de novo biosynthesis I (6/6 steps found)
• NAD de novo biosynthesis III (5/6 steps found)
• NAD de novo biosynthesis IV (anaerobic) (5/6 steps found)
• nicotine biosynthesis (3/9 steps found)
• superpathway of nicotine biosynthesis (4/12 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.72

Sequence Analysis Tools

See Q72B30 at UniProt or InterPro

Protein Sequence (358 amino acids)

>DVU1808 quinolinate synthetase complex, subunit A (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTLHRPTPASSGETPQDVARRIDALRGQLGDDVLVMGHHYQHDSVIRHTDLRGDSLELAR
KVDAISAKHIVFCGVYFMAESAALLARDGQSVHIPESDANCVMSQMAPAQRVDAVLRNLS
GTGRNVIPLAYVNTSLAVKAVVGRHGGAVCTSANAKTMLTWARERADAVVFLPDKNLARN
TADLLGIAEDRRHILDIRDGGAAVDMDAASGAELLMWPGCCAIHARFNLRQMERMRDEHP
GCRIAVHPECSPEVVRAADAAGSTSFLIRYAEEQKPGTTLVIGTEINLVERLAAQHAGRI
TVLPLLESGCSHMARVTAPKLLATLESIASGTASPVAIPLDLQDDAHAALQRMLEACA