Protein Info for DVU1805 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: GGDEF domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 311 to 472 (162 residues), 173.4 bits, see alignment E=1.7e-55 PF00990: GGDEF" amino acids 313 to 470 (158 residues), 164.9 bits, see alignment E=6.8e-53

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1805)

Predicted SEED Role

"GGDEF domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B33 at UniProt or InterPro

Protein Sequence (487 amino acids)

>DVU1805 GGDEF domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKHQHLMWNIGLSDLDAARISEFAGAGYTMQTVPADALPSPDDLEREAPCIIWVAASVQA
ALAAHPRQLRQHLELVPRALVLDVSYTQNDLEQALDLDFSEIVRHPISRKRVLTVLRRAV
ETRNVHQDILRMTREILLERELLARKNDLLSFVVTFLTRTTESLDIADILINAREGFGKL
LPVTGLHAILWPPSPTEGAHDAELFIGAYRQTEAHAAWTRLLLESAHRLARHDVAEYRTT
ALTHDEPSPLPEAGRVMMLPLGNGKNTFGAIAMALAETPALGKDQAQALDSVMRHLTLAL
RNAVVYREIKLQADHDALTQLHNRRSFDHRLAEEVDRHQRYGMPMTLLMLDIDHFKAVND
TYGHPAGDAVLREVAQTMRNACRTTDFAARYGGEEFCVILPHTDGKCGRIFAERLRKRLA
SSRVEVDGKTIAVTVSIGLATLSAAAPLSPERLVCEADGALYAAKAAGRNIVCEAQEPCQ
RANALRA