Protein Info for DVU1775 in Desulfovibrio vulgaris Hildenborough JW710

Name: ribB
Annotation: 3,4-dihydroxy-2-butanone 4-phosphate synthase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 214 TIGR00506: 3,4-dihydroxy-2-butanone-4-phosphate synthase" amino acids 14 to 209 (196 residues), 247.1 bits, see alignment E=5.7e-78 PF00926: DHBP_synthase" amino acids 20 to 208 (189 residues), 275.1 bits, see alignment E=1.4e-86

Best Hits

Swiss-Prot: 100% identical to RIBB_DESVH: 3,4-dihydroxy-2-butanone 4-phosphate synthase (ribB) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02858, 3,4-dihydroxy 2-butanone 4-phosphate synthase [EC: 4.1.99.12] (inferred from 100% identity to dvl:Dvul_1381)

MetaCyc: 68% identical to 3,4-dihydroxy-2-butanone-4-phosphate synthase (Escherichia coli K-12 substr. MG1655)
3,4-dihydroxy-2-butanone-4-phosphate synthase. [EC: 4.1.99.12]

Predicted SEED Role

"3,4-dihydroxy-2-butanone 4-phosphate synthase (EC 4.1.99.12)" (EC 4.1.99.12)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.99.12

Use Curated BLAST to search for 4.1.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B63 at UniProt or InterPro

Protein Sequence (214 amino acids)

>DVU1775 3,4-dihydroxy-2-butanone 4-phosphate synthase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNQHLLEQFGTTHERVERGLAALRTGQGVLVADDADRENEGDLIFAAETLTPAQMAMMIR
ECSGIVCLCLPEERVSRLGLPMMVAHNTSSMGTAFTISIEAAEGVTTGVSAADRVRTVKA
AIDDAACPGCLRSPGHVFPLRASPGGVLERRGHTEATVDLMRLAGLKPYGVLCELTNPDG
TMARLPQLVDFAQRNRMTVLTVEDLVAYRQDKGL