Protein Info for DVU1771 in Desulfovibrio vulgaris Hildenborough JW710

Name: hydC
Annotation: [Fe] hydrogenase gamma (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13510: Fer2_4
  • amino acids 4 to 80 (77 residues), 56.3 bits, E=1.2e-18
• PF00111: Fer2
  • amino acids 5 to 70 (66 residues), 33.7 bits, E=1.3e-11
• PF10588: NADH-G_4Fe-4S_3
  • amino acids 88 to 124 (37 residues), 49 bits, 1.6e-16
• TIGR02512: [FeFe] hydrogenase, group A
  • amino acids 144 to 519 (376 residues), 532.1 bits, E=3.4e-164
• PF13237: Fer4_10
  • amino acids 145 to 206 (62 residues), 24.9 bits, E=7.6e-09
• PF13183: Fer4_8
  • amino acids 149 to 208 (60 residues), 28.6 bits, 8e-10
• PF12838: Fer4_7
  • amino acids 151 to 209 (59 residues), 31.4 bits, 1e-10
• PF00037: Fer4
  • amino acids 193 to 210 (18 residues), 26.1 bits, see alignment (E = 2.6e-09)
• PF02906: Fe_hyd_lg_C
  • amino acids 230 to 515 (286 residues), 295.7 bits, E=1.4e-91
• PF02256: Fe_hyd_SSU
  • amino acids 528 to 580 (53 residues), 67.1 bits, 5.1e-22

Best Hits

KEGG orthology group: K06441, ferredoxin hydrogenase gamma subunit [EC: 1.12.7.2] (inferred from 100% identity to dvl:Dvul_1384)

Predicted SEED Role

"Periplasmic [Fe] hydrogenase large subunit (EC 1.12.7.2)" in subsystem Hydrogenases (EC 1.12.7.2)

MetaCyc Pathways

• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of photosynthetic hydrogen production (2/6 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2

Use Curated BLAST to search for 1.12.7.2

Sequence Analysis Tools

See Q72B67 at UniProt or InterPro

Protein Sequence (606 amino acids)

>DVU1771 [Fe] hydrogenase gamma (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNAFINGKEVRCEPGRTILEAARENGHFIPTLCELADIGHAPGTCRVCLVEIWRDKEAGP
QIVTSCTTPVEEGMRIFTRTPEVRRMQRLQVELLLADHDHDCAACARHGDCELQDVAQFV
GLTGTRHHFPDYARSRTRDVSSPSVVRDMGKCIRCLRCVAVCRNVQGVDALVVTGNGIGT
EIGLRHNRSQSASDCVGCGQCTLVCPVGALAGRDDVERVIDYLYDPEIVTVFQFAPAVRV
GLGEEFGLPPGSSVEGQVPTALRLLGADVVLDTNFAADLVIMEEGTELLQRLRGGAKLPL
FTSCCPGWVNFAEKHLPDILPHVSTTRSPQQCLGALAKTYLARTMNVAPERMRVVSLMPC
TAKKEEAARPEFRRDGVRDVDAVLTTREFARLLRREGIDLAGLEPSPCDDPLMGRATGAA
VIFGTTGGVMEAALRTVYHVLNGKELAPVELHALRGYENVREAVVPLGEGNGSVKVAVVH
GLKAARQMVEAVLAGKADHVFVEVMACPGGCMDGGGQPRSKRAYNPNAQARRAALFSLDA
ENALRQSHNNPLIGKVYESFLGEPCSNLSHRLLHTRYGDRKSEVAYTMRDIWHEMTLGRR
VRGDSD