Protein Info for DVU1769 in Desulfovibrio vulgaris Hildenborough JW710

Name: hydA
Annotation: periplasmic [Fe] hydrogenase, large subunit (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02512: [FeFe] hydrogenase, group A
  • amino acids 28 to 390 (363 residues), 517.9 bits, E=6.8e-160
• PF00037: Fer4
  • amino acids 28 to 50 (23 residues), 29.8 bits, see alignment (E = 1.3e-10)
  • amino acids 64 to 82 (19 residues), 24.1 bits, see alignment (E = 8.2e-09)
• PF13237: Fer4_10
  • amino acids 28 to 77 (50 residues), 30.9 bits, 7.5e-11
• PF13187: Fer4_9
  • amino acids 34 to 81 (48 residues), 31.4 bits, 5.4e-11
• PF02906: Fe_hyd_lg_C
  • amino acids 101 to 386 (286 residues), 318.2 bits, E=1.4e-98

Best Hits

Swiss-Prot: 100% identical to PHFL_DESVH: Periplasmic [Fe] hydrogenase large subunit (hydA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K00533, ferredoxin hydrogenase large subunit [EC: 1.12.7.2] (inferred from 100% identity to dvl:Dvul_1386)

MetaCyc: 100% identical to cytochrome-c3 [Fe]-hydrogenase large subunit (Desulfovibrio vulgaris)
Cytochrome-c3 hydrogenase. [EC: 1.12.2.1]

Predicted SEED Role

"Periplasmic [Fe] hydrogenase large subunit (EC 1.12.7.2)" in subsystem Hydrogenases (EC 1.12.7.2)

MetaCyc Pathways

• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (7/8 steps found)
• superpathway of fermentation (Chlamydomonas reinhardtii) (7/9 steps found)
• hydrogen production III (1/1 steps found)
• hydrogen production VIII (1/1 steps found)
• hydrogen production VI (1/2 steps found)
• superpathway of hydrogen production (1/2 steps found)
• superpathway of photosynthetic hydrogen production (2/6 steps found)
• L-glutamate degradation VII (to butanoate) (4/12 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• Methane metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.12.7.2

Use Curated BLAST to search for 1.12.2.1 or 1.12.7.2

Sequence Analysis Tools

See P07598 at UniProt or InterPro

Protein Sequence (421 amino acids)

>DVU1769 periplasmic [Fe] hydrogenase, large subunit (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSRTVMERIEYEMHTPDPKADPDKLHFVQIDEAKCIGCDTCSQYCPTAAIFGEMGEPHSI
PHIEACINCGQCLTHCPENAIYEAQSWVPEVEKKLKDGKVKCIAMPAPAVRYALGDAFGM
PVGSVTTGKMLAALQKLGFAHCWDTEFTADVTIWEEGSEFVERLTKKSDMPLPQFTSCCP
GWQKYAETYYPELLPHFSTCKSPIGMNGALAKTYGAERMKYDPKQVYTVSIMPCIAKKYE
GLRPELKSSGMRDIDATLTTRELAYMIKKAGIDFAKLPDGKRDSLMGESTGGATIFGVTG
GVMEAALRFAYEAVTGKKPDSWDFKAVRGLDGIKEATVNVGGTDVKVAVVHGAKRFKQVC
DDVKAGKSPYHFIEYMACPGGCVCGGGQPVMPGVLEAMDRTTTRLYAGLKKRLAMASANK
A