Protein Info for DVU1768 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: GTP-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 410 TIGR03918: [FeFe] hydrogenase H-cluster maturation GTPase HydF" amino acids 4 to 394 (391 residues), 542.3 bits, see alignment E=6.2e-167 TIGR00231: small GTP-binding protein domain" amino acids 11 to 130 (120 residues), 51.6 bits, see alignment E=9.1e-18 PF01926: MMR_HSR1" amino acids 11 to 125 (115 residues), 71.3 bits, see alignment E=1.1e-23 PF18128: HydF_dimer" amino acids 178 to 276 (99 residues), 124.1 bits, see alignment E=3.2e-40 PF18133: HydF_tetramer" amino acids 280 to 395 (116 residues), 140.7 bits, see alignment E=2.8e-45

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1768)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72B68 at UniProt or InterPro

Protein Sequence (410 amino acids)

>DVU1768 GTP-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQDTPKGLRLHIGIYGRRNVGKSSLLNALTRQTVSIVSATPGTTTDPVEKTMEMAPIGPV
VFIDTAGIDDTGDLGLMRSDRTRQMFDRTDLALVASEGDVWGDYERDLVAAFRERKIPVI
AVLTKGDETPVAQTVRQSLLAEGIESAAVCSTDGRGIDALRALMARMAPEHAISQPALLA
DLVPAGGLVIFVVPIDLGAPKGRLILPQVQAIRDILDGDAMCMVVKERELRPALDRLTQP
PDLVVCDSQVVLKAAADTPPGIPLTTFSILMARFKGELETLARGAAVIETLAPGDRVLVA
EACTHHPLADDIGRVKIPRWLRQYAGGNIHIDTFAGKDMPADLSGYRLIIHCGGCVITRG
HMLGRMHAAAAAGVPMTNYGLAISLTQGVLHRALGPFPAAQEAFDSIPRG