Protein Info for DVU1766 in Desulfovibrio vulgaris Hildenborough JW710

Name: aspA
Annotation: aspartate ammonia-lyase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00206: Lyase_1
  • amino acids 19 to 344 (326 residues), 265.1 bits, E=1e-82
• PF10415: FumaraseC_C
  • amino acids 414 to 464 (51 residues), 46.1 bits, 5.5e-16

Best Hits

Swiss-Prot: 47% identical to ASPA_PSEAE: Aspartate ammonia-lyase (aspA) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K01744, aspartate ammonia-lyase [EC: 4.3.1.1] (inferred from 100% identity to dvu:DVU1766)

Predicted SEED Role

No annotation

MetaCyc Pathways

• L-glutamate degradation II (2/2 steps found)
• superpathway of L-aspartate and L-asparagine biosynthesis (3/4 steps found)
• L-aspartate degradation II (aerobic) (2/3 steps found)
• L-aspartate degradation III (anaerobic) (2/3 steps found)
• L-canavanine degradation II (1/6 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Nitrogen metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.3.1.1

Use Curated BLAST to search for 4.3.1.1

Sequence Analysis Tools

See Q72B70 at UniProt or InterPro

Protein Sequence (470 amino acids)

>DVU1766 aspartate ammonia-lyase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSLSDQDAIRIEHDLLGDCAVPRTALHGAHTQRALSNVALSGRPLHPEIIRAFGAVKRAC
ARTNMNLGHLSREVAEAIIMACDELEDGGLGEHIVVDALQGGAGTSANMNVNEVLANRAE
EMLGGTRGQYQLVDPLAHVNLHQSTNDVFPTAVRIAALRLLARLEPAIAALQSAFQTHEA
SFAQVVRLGRTQLQDAVPMTFGAACGAWAEALSRDRWRVFKCSERLRVVNLGGTAIGTGI
AAPRSYILSVVDRLREDTGLPLARAENLMDATQNVDAFVEVSGILKAHASNLLKLSSDLR
LLASGPGGGIGEVVLPPVQAGSSIMPGKVNPVVCETVAQAAMQATANDLAITLSAQHGQL
ELNAFMPLIADALLHGIELLTNACDLFRTRCVEGLHPDTETCARHVSTSTATLTALVPEI
GYAAASEMARHMREHGTDVFGAAKATGLIDEDRLARLLSPERLVALGYRG