Protein Info for DVU1686 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ATPase, AAA family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF05496: RuvB_N" amino acids 11 to 117 (107 residues), 51.6 bits, see alignment E=2.8e-17 PF00004: AAA" amino acids 41 to 138 (98 residues), 40.5 bits, see alignment E=1.1e-13 PF16193: AAA_assoc_2" amino acids 160 to 233 (74 residues), 73.9 bits, see alignment E=3.1e-24 PF12002: MgsA_C" amino acids 234 to 399 (166 residues), 226.1 bits, see alignment E=7.5e-71

Best Hits

KEGG orthology group: K07478, putative ATPase (inferred from 100% identity to dvl:Dvul_1401)

Predicted SEED Role

"ATPase, AAA family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BF0 at UniProt or InterPro

Protein Sequence (411 amino acids)

>DVU1686 ATPase, AAA family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSVRQPLPERLRPTVLEGFVGQTHLTQRIEALLRANRLPSLLLFGPPGCGKSTLALLLAK
ARSANVLRLSAPEAGLQHLRKQLHGVDILVLDELHRFSKAQQDFFLPLLESGDITMLATT
TENPSFSVTRQLLSRLHVLRLRPLGRAELLELGRRGAVAQEVQIEDDVLDLLASMSHGDA
RTMLNLLEYVAALPEDKRDIEGVRSAMPEIVSRHDKDGDNHYELASALIKSIRGSDPDAA
LYYLACLLEGGEDPRFVCRRLILSASEDVGLADPQALPLAVACMQAVEYVGMPEGFIPMA
QTTVHLALARKSNSTYAAYINAARELKTQGRKGVPLHLRNPSTRLQKEWGYGKGYRYPHS
YPEGWIEQEYLPEGLEDRRFYAPRENGEEPRLSAWWRKLQRQRPPRRGSGE