Protein Info for DVU1681 in Desulfovibrio vulgaris Hildenborough JW710

Name: mreB-2
Annotation: rod shape-determining protein MreB (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 340 TIGR00904: cell shape determining protein, MreB/Mrl family" amino acids 11 to 332 (322 residues), 455.5 bits, see alignment E=5.1e-141 PF06723: MreB_Mbl" amino acids 11 to 332 (322 residues), 445.1 bits, see alignment E=2.5e-137 PF00012: HSP70" amino acids 105 to 203 (99 residues), 34.6 bits, see alignment E=1.4e-12 PF14450: FtsA" amino acids 157 to 314 (158 residues), 36.8 bits, see alignment E=9.2e-13

Best Hits

Swiss-Prot: 53% identical to MREB_BACSU: Cell shape-determining protein MreB (mreB) from Bacillus subtilis (strain 168)

KEGG orthology group: K03569, rod shape-determining protein MreB and related proteins (inferred from 100% identity to dvl:Dvul_1406)

Predicted SEED Role

"Rod shape-determining protein MreB" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BF5 at UniProt or InterPro

Protein Sequence (340 amino acids)

>DVU1681 rod shape-determining protein MreB (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLRKLFGFLGKDLAMDLGTANTLLFTRADGIVLNEPSVVAIETERNSVLAVGREAKEYLG
RTPQRIRAIRPMKDGVIADFEVTRQMIEFFIRKVIKGFNIVKPGIVICVPTGITQVEKRA
VIESATQAGARDVRLVEEPMAAAIGANLPIHEPLGSMVVDIGGGTTEVAVISLSAIAYAE
SVRMAGDAMNHAIQRYFQEEFQLLIGENMSERIKMSIGSAFPLPEQLLMEVSGKDMLTGT
PKVVRVSDGHIREALREPVRVILTAIRRALEKTPPELAGDIARNGLLLAGGGSLLKGLDA
LVARETRLKVIIDEDPLTTVVRGTGRTLDDRKFFSRVYIN