Protein Info for DVU1673 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: acyltransferase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 314 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF03279: Lip_A_acyltrans" amino acids 59 to 293 (235 residues), 131.5 bits, see alignment E=1.9e-42

Best Hits

KEGG orthology group: K02517, lipid A biosynthesis lauroyl acyltransferase [EC: 2.3.1.-] (inferred from 99% identity to dvl:Dvul_1414)

Predicted SEED Role

"Lipid A biosynthesis lauroyl acyltransferase (EC 2.3.1.-)" in subsystem KDO2-Lipid A biosynthesis (EC 2.3.1.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BG3 at UniProt or InterPro

Protein Sequence (314 amino acids)

>DVU1673 acyltransferase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNRSASSFVLSALSGFASLAGKASFEGLATFGDRMGDLMWYAMPGRRQYTTQTIIERLGV
PADRAEQLARASFRHNARSFLEILHVHRFGFEDRGGRLHIAQPDLFDALLRSNRPIVGVT
AHLGAWELFSGLLGQFDASRPRIVVVRRQGNPTLNALIMRLRSARGAEVIEHRDAARKVL
RGLKHNGMAGFLVDHNCNRREAVFLPFLGKQAAVNVGPALLALRAEAEVWPIFLVREDDR
YVLRFSSPLDTRLVSGERAQRIETVAAFYTQAVEEHVRAFPEQWFWMHKRWKTRPVASEA
PKGAKAPEEKDLSV