Protein Info for DVU1667 in Desulfovibrio vulgaris Hildenborough JW710

Name: ftsK
Annotation: FtsK/SpoIIIE family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 signal peptide" amino acids 1 to 21 (21 residues), see Phobius details transmembrane" amino acids 47 to 72 (26 residues), see Phobius details amino acids 83 to 103 (21 residues), see Phobius details amino acids 135 to 156 (22 residues), see Phobius details PF13491: FtsK_4TM" amino acids 1 to 160 (160 residues), 98.3 bits, see alignment E=8.4e-32 PF17854: FtsK_alpha" amino acids 300 to 400 (101 residues), 110.4 bits, see alignment E=8.8e-36 PF01580: FtsK_SpoIIIE" amino acids 410 to 607 (198 residues), 219.6 bits, see alignment E=7.5e-69 PF09397: FtsK_gamma" amino acids 714 to 772 (59 residues), 93.5 bits, see alignment 1.1e-30

Best Hits

KEGG orthology group: K03466, DNA segregation ATPase FtsK/SpoIIIE, S-DNA-T family (inferred from 100% identity to dvl:Dvul_1420)

Predicted SEED Role

"Cell division protein FtsK" in subsystem Bacterial Cell Division or Bacterial Cytoskeleton or Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BG9 at UniProt or InterPro

Protein Sequence (776 amino acids)

>DVU1667 FtsK/SpoIIIE family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLGLFLIFWGLLLLLSLATFDLRDPSLNHVVSNPTEIRNGAGMFGSYLGGMLADAFGIAA
FLWPVGFIGLGARYIIVSFDIAWWRWAGLLALSLCMVTAGAAWELSLGDVNAGGVLGDLL
YRFSWKALSPRGSTLVWLFLCIIGLQLTFDISWTALFRRIVDKVRADLEAHPVSRPQLPE
LKLPRLGLPSGLHLPGRKGAEGNAPATLAVVDVTPDGSDSTNGAPSVVAREASTPRGMPV
ETDDFVLSEDRLQPPASELPFEVVLDADTDGVADLTADVESDISEGAGRPKAKMRRKSQL
PPLDLLHSALNEDSRPDREVLEGKGLSLTNCLSDFGVQGELTRITPGPVVTMFEFRPAPG
VKVSRIANLSDDLALALKAIAVRIQAPIPGTDTVGIEIPNETRETVCFKELLSSDTFKGA
SSLLTLAIGKDIAGRPTVADLSKMPHLLVAGATGAGKSVCLNSILLSILYKARPEDVKLL
LVDPKRIELAVYADLPHLVHPVVTEMAHAKNALDWAVHEMDKRYEGMARLGVRNIAGYNQ
KLEDMGKERPADLADLEAMPYLVIIIDELADLMLTAAKEVETSIVRLAQLARAAGIHLIL
ATQRPSVDVVTGLIKANFPCRISFQVTSKHDSRTILDTVGAEFLLGKGDMLFKPSGGKLQ
RLHGAFVSDDDVNGVVAFWKKQQPPSYKVDFAEWGNEGTLDGNGGSGGAGDLADDPVYAE
AVEFVMGQGRASISLIQRRFRIGFNRAARYVEQMEQDGIIGPADGSKPRSVIRGKE