Protein Info for DVU1660 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: undecaprenol kinase, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details transmembrane" amino acids 43 to 62 (20 residues), see Phobius details amino acids 82 to 101 (20 residues), see Phobius details amino acids 108 to 128 (21 residues), see Phobius details amino acids 146 to 163 (18 residues), see Phobius details amino acids 183 to 204 (22 residues), see Phobius details amino acids 215 to 240 (26 residues), see Phobius details amino acids 247 to 264 (18 residues), see Phobius details PF02673: BacA" amino acids 7 to 256 (250 residues), 258.2 bits, see alignment E=4.9e-81 TIGR00753: undecaprenyl-diphosphatase UppP" amino acids 7 to 256 (250 residues), 236.3 bits, see alignment E=2.2e-74

Best Hits

Swiss-Prot: 100% identical to UPPP_DESVH: Undecaprenyl-diphosphatase (uppP) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K06153, undecaprenyl-diphosphatase [EC: 3.6.1.27] (inferred from 100% identity to dvl:Dvul_1427)

Predicted SEED Role

"Undecaprenyl-diphosphatase (EC 3.6.1.27)" (EC 3.6.1.27)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.27

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P62464 at UniProt or InterPro

Protein Sequence (265 amino acids)

>DVU1660 undecaprenol kinase, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSDMITAAILGLVEGLTEFLPVSSTGHLIITGELLGFTGPKATTFEVAIQLGAILAVVVL
YWDRFWGLLRPQPYVRFAGLRGIMLLLLTSLPASVLGLAAHSTIKAHLFTPSTVAIALAV
GAIFMLLVERRTERPRYMTLDEMSPALALGIGCFQCLALWPGFSRSAATIMGGMLLGARR
GLAAEYSFIAAVPIMFAATGYDLLKSWTLFTPADLPFFATGFVVSFLSAWAAVKLFIALV
GRMTFRPFAWYRLAIAPLVYYFMAY