Protein Info for DVU1647 in Desulfovibrio vulgaris Hildenborough JW710

Name: lysA-1
Annotation: diaminopimelate decarboxylase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 TIGR01048: diaminopimelate decarboxylase" amino acids 6 to 411 (406 residues), 532.6 bits, see alignment E=2.6e-164 PF00278: Orn_DAP_Arg_deC" amino acids 30 to 369 (340 residues), 102.4 bits, see alignment E=1.3e-33 PF02784: Orn_Arg_deC_N" amino acids 35 to 279 (245 residues), 210.9 bits, see alignment E=2e-66

Best Hits

Swiss-Prot: 54% identical to DCDA_HAEIN: Diaminopimelate decarboxylase (lysA) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01586, diaminopimelate decarboxylase [EC: 4.1.1.20] (inferred from 100% identity to dvl:Dvul_1439)

Predicted SEED Role

"Diaminopimelate decarboxylase (EC 4.1.1.20)" in subsystem Lysine Biosynthesis DAP Pathway (EC 4.1.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.20

Use Curated BLAST to search for 4.1.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BI9 at UniProt or InterPro

Protein Sequence (412 amino acids)

>DVU1647 diaminopimelate decarboxylase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHLFQYREGSLFAEDVSIIDLASTYGTPLYVYSAGTLERHYRAFDSAFGKAAHLTCFSVK
ACSNIHILKLLGSLGAGVDIVSGGELHRALLAGIPGRRIVYSGVGKRPDEIRSALEADIL
MFNVESLQELRTIEEVAASMGTTARVSLRINPDVDPHTHPYISTGLQKNKFGIEMTQALE
GYMLARDLPHIDPIGIDCHIGSQLTSLSPFLEALDKVLEFREHLSILGLDISYLDLGGGL
GITYGEETPPHPRDFGRAVLERTKGLNLTLVLEPGRVIAGNAGILVTEVLYTKTTPSKQF
VIVDAAMNDLVRPSLYASYHRIAEVLPHGRTEQTVDVVGPICESGDFLARDRVLPAVEQG
ELLAVFSAGAYGFSMSSQYNSRPRAAEVLVRGDTAKSIRRRETYDDLTALEG