Protein Info for DVU1644 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: permease, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 371 transmembrane" amino acids 22 to 42 (21 residues), see Phobius details amino acids 64 to 90 (27 residues), see Phobius details amino acids 110 to 135 (26 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details amino acids 174 to 194 (21 residues), see Phobius details amino acids 249 to 267 (19 residues), see Phobius details amino acids 279 to 301 (23 residues), see Phobius details amino acids 310 to 331 (22 residues), see Phobius details amino acids 342 to 364 (23 residues), see Phobius details PF03773: ArsP_1" amino acids 66 to 364 (299 residues), 208.1 bits, see alignment E=8.4e-66

Best Hits

KEGG orthology group: K07089, (no description) (inferred from 100% identity to dvu:DVU1644)

Predicted SEED Role

"permease, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BJ2 at UniProt or InterPro

Protein Sequence (371 amino acids)

>DVU1644 permease, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTQCSCKNSMGPSSGDHADPKLVYIVKAAVVSVVWLFCYMMLETWAEFITLKLLRIDIST
RLGSSIVFFMYDTVKILMLLVMMVYGIAWMRAGLNVERVRTYLAGKRQALGYPLAACFGA
VTPFCSCSSVPLFIGFSTAGIPLGITMAFLITSPLVNEVAVVLLWGLLGWKLTLVYVGIG
LLAGVFGGGCMSWVKAERWLQPFIRQAMRPAGGGLTPFAPLPSAVAPKMTWRDRHSFAKN
ETSSIFSRVWKWVIGGVALGAALHGYLPQEWVEETLGKGQWWSVPAAVAVGIPLYANVTG
IIPVMESLLLKGMPIGTTLALCMSAVGASLPEFIMLKQVMQWRLLALFGGLLLVLFTCAG
WLLNMVENILR