Protein Info for DVU1631 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: conserved hypothetical protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 303 PF03668: RapZ-like_N" amino acids 18 to 171 (154 residues), 138.7 bits, see alignment E=1.5e-44 PF22740: PapZ_C" amino acids 182 to 301 (120 residues), 149.1 bits, see alignment E=6.7e-48

Best Hits

Swiss-Prot: 100% identical to Y1631_DESVH: Nucleotide-binding protein DVU_1631 (DVU_1631) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K06958, UPF0042 nucleotide-binding protein (inferred from 100% identity to dvl:Dvul_1502)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BK4 at UniProt or InterPro

Protein Sequence (303 amino acids)

>DVU1631 conserved hypothetical protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSSPARSADDGFEAGFPVLIVSGLSGAGKSTVLNVFEDLRYFTVDGLPVRLAPDMVRVLD
AQALEQYQGIVLGMDLREAEFVQQFEQALARLQEMGVRPVLLFIEAEQGELMRRYATTRR
PHPLESEGMGLELALAEERRRLAPVREAADLVFDTTSFSIHDLRRVIQRRWSSLKGRMRS
LRVNIISFGYKYGVPKEADLVFDLRFLPNPYFDTSLRPQSGLDAPVVEYVFGTDSARTFR
DRFIDFMTYLLPLYEAEGRYRIAVAIGCTGGRHRSVATAEALLDVLRKSDYAVTIEHRHL
ELG