Protein Info for DVU1627 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: ABC transporter, ATP-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR04406: LPS export ABC transporter ATP-binding protein" amino acids 5 to 241 (237 residues), 372.4 bits, see alignment E=4e-116 PF00005: ABC_tran" amino acids 21 to 166 (146 residues), 132 bits, see alignment E=1.2e-42

Best Hits

Swiss-Prot: 54% identical to LPTB_HAEIN: Lipopolysaccharide export system ATP-binding protein LptB (lptB) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K06861, lipopolysaccharide export system ATP-binding protein [EC: 3.6.3.-] (inferred from 100% identity to dvl:Dvul_1506)

MetaCyc: 56% identical to LPS export ABC transporter ATP-binding protein (Salmonella enterica enterica serovar Typhimurium str. LT2)
RXN1R65-51 [EC: 7.5.2.5]

Predicted SEED Role

"Lipopolysaccharide ABC transporter, ATP-binding protein LptB" in subsystem KDO2-Lipid A biosynthesis

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 3.6.3.-

Use Curated BLAST to search for 3.6.3.- or 7.5.2.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BK8 at UniProt or InterPro

Protein Sequence (241 amino acids)

>DVU1627 ABC transporter, ATP-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MMAVLQGEDLRKRFGQREVVRGVSVSVQQGEIVGLLGPNGAGKTTTFYMLTGIIKPTAGI
VRLDGQDIADWPLHERARVGLSYLPQESSVFKRLTVRENLEIILEHTGLPAARQKERAEA
LMADFGIAHLASSRAMHLSGGERRRLEIARCMIREPKFVLLDEPFAGIDPLAVGDIQGLI
RKLRDRGIGVLISDHNVRETLTICDRAYLVHQGQVILDGTPEHIVGDEQARLVYLGADFC
L