Protein Info for DVU1624 in Desulfovibrio vulgaris Hildenborough JW710

Name: kdsA
Annotation: 2-dehydro-3-deoxyphosphooctonate aldolase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 273 PF00793: DAHP_synth_1" amino acids 17 to 260 (244 residues), 230.9 bits, see alignment E=6.8e-73 TIGR01362: 3-deoxy-8-phosphooctulonate synthase" amino acids 18 to 266 (249 residues), 373.5 bits, see alignment E=2.2e-116

Best Hits

Swiss-Prot: 100% identical to KDSA_DESVH: 2-dehydro-3-deoxyphosphooctonate aldolase (kdsA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01627, 2-dehydro-3-deoxyphosphooctonate aldolase (KDO 8-P synthase) [EC: 2.5.1.55] (inferred from 100% identity to dvl:Dvul_1510)

MetaCyc: 52% identical to 3-deoxy-8-phosphooctulonate synthase subunit (Arabidopsis thaliana col)
3-deoxy-8-phosphooctulonate synthase. [EC: 2.5.1.55]

Predicted SEED Role

"2-Keto-3-deoxy-D-manno-octulosonate-8-phosphate synthase (EC 2.5.1.55)" in subsystem KDO2-Lipid A biosynthesis (EC 2.5.1.55)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.5.1.55

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P61654 at UniProt or InterPro

Protein Sequence (273 amino acids)

>DVU1624 2-dehydro-3-deoxyphosphooctonate aldolase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQHPTPDALHARLAARRFILAGPCALEDFDVAMETAHAVREAAEAAGLFAVFKSSWDKAN
RTSITSFRGPGLVRGMEWLARIREESGLPVVTDIHLPEQAAPVAEVADIIQIPAFLCRQT
DLLVAAAATGRVVNVKKGQFVAPWDMRPAVEKLRAAGNERILLTERGASFGYNNLVVDYR
SIPTMQGFGVPVVFDATHSVQLPGGLGGSSGGERRHVPVLARAAVAAGVDGVFLECHPDP
DKALCDGPNSWPLDRLPALLKELSALWSLEHVC