Protein Info for DVU1623 in Desulfovibrio vulgaris Hildenborough JW710

Name: pyrG
Annotation: CTP synthase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 547 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details TIGR00337: CTP synthase" amino acids 2 to 538 (537 residues), 817.9 bits, see alignment E=1.8e-250 PF06418: CTP_synth_N" amino acids 4 to 266 (263 residues), 420.3 bits, see alignment E=4.6e-130 PF00117: GATase" amino acids 303 to 537 (235 residues), 145 bits, see alignment E=3.4e-46 PF07722: Peptidase_C26" amino acids 365 to 520 (156 residues), 25.7 bits, see alignment E=1.4e-09

Best Hits

Swiss-Prot: 100% identical to PYRG_DESVH: CTP synthase (pyrG) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 100% identity to dvl:Dvul_1511)

MetaCyc: 58% identical to CTP synthetase (Escherichia coli K-12 substr. MG1655)
CTP synthase. [EC: 6.3.4.2]

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BL2 at UniProt or InterPro

Protein Sequence (547 amino acids)

>DVU1623 CTP synthase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKTKFIFITGGVLSSLGKGLAAASVGALLKARGLKVTIQKLDPYINVDPGTMNPFQHGEV
YVTDDGAETDLDLGHYERYLAEPMSQKNNYTSGSIYHRVITKERRGDYLGGTVQVIPHVT
DEIKNAVLSLAEDDPDVALIEIGGTVGDIEGLPFLEAIRQLRGDLGKDRCLYIHLTLVPY
LRAAGEHKTKPTQHSVKELRSIGIQPDIILCRCEEAITADLKRKIALFCNVDQDAVFSAV
DVKNIYEVPLRFYEEGFDQKIAIMLRLPAKNPNLEPWETLVDTCAHPQGRVTIGIVGKYV
DLKEAYKSLHEALVHGGVANKVAVDLKYVNSEEITEENVAEALKGLDGILVPGGFGYRGV
EGKILTIRYARENRVPFFGICLGMQCAVIEFARNVMGLEDANSEEFNELSKNKVIYLMTE
WFDHRRQAVERRDSSSDKGGTMRLGSYPCVVVPDTKAHDAYGVKHIDERHRHRFEFNKAY
FDAMAQSGMVFSGLSPDGELVEIVELPDHPWFLGCQFHPEFKSNPMQPHPLFREFIRAAK
THPAGKR