Protein Info for DVU1623 in Desulfovibrio vulgaris Hildenborough JW710

Name: pyrG
Annotation: CTP synthase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00337: CTP synthase
  • amino acids 2 to 538 (537 residues), 817.9 bits, E=1.8e-250
• PF06418: CTP_synth_N
  • amino acids 4 to 266 (263 residues), 420.4 bits, E=4.4e-130
• PF00117: GATase
  • amino acids 303 to 537 (235 residues), 143.9 bits, E=7.4e-46
• PF07722: Peptidase_C26
  • amino acids 365 to 520 (156 residues), 25.5 bits, E=1.6e-09

Best Hits

Swiss-Prot: 100% identical to PYRG_DESVH: CTP synthase (pyrG) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 100% identity to dvl:Dvul_1511)

MetaCyc: 58% identical to CTP synthetase (Escherichia coli K-12 substr. MG1655)
CTP synthase. [EC: 6.3.4.2]

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (42/46 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (16/18 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (8/9 steps found)
• superpathway of pyrimidine nucleobases salvage (4/4 steps found)
• UTP and CTP de novo biosynthesis (3/3 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (3/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (3/4 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• L-glutamate and L-glutamine biosynthesis (4/7 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Sequence Analysis Tools

See Q72BL2 at UniProt or InterPro

Protein Sequence (547 amino acids)

>DVU1623 CTP synthase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKTKFIFITGGVLSSLGKGLAAASVGALLKARGLKVTIQKLDPYINVDPGTMNPFQHGEV
YVTDDGAETDLDLGHYERYLAEPMSQKNNYTSGSIYHRVITKERRGDYLGGTVQVIPHVT
DEIKNAVLSLAEDDPDVALIEIGGTVGDIEGLPFLEAIRQLRGDLGKDRCLYIHLTLVPY
LRAAGEHKTKPTQHSVKELRSIGIQPDIILCRCEEAITADLKRKIALFCNVDQDAVFSAV
DVKNIYEVPLRFYEEGFDQKIAIMLRLPAKNPNLEPWETLVDTCAHPQGRVTIGIVGKYV
DLKEAYKSLHEALVHGGVANKVAVDLKYVNSEEITEENVAEALKGLDGILVPGGFGYRGV
EGKILTIRYARENRVPFFGICLGMQCAVIEFARNVMGLEDANSEEFNELSKNKVIYLMTE
WFDHRRQAVERRDSSSDKGGTMRLGSYPCVVVPDTKAHDAYGVKHIDERHRHRFEFNKAY
FDAMAQSGMVFSGLSPDGELVEIVELPDHPWFLGCQFHPEFKSNPMQPHPLFREFIRAAK
THPAGKR