Protein Info for DVU1606 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: potassium uptake protein, TrkA family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 21 to 47 (27 residues), see Phobius details amino acids 54 to 72 (19 residues), see Phobius details amino acids 81 to 106 (26 residues), see Phobius details PF07885: Ion_trans_2" amino acids 34 to 106 (73 residues), 59.5 bits, see alignment E=3.6e-20 PF02254: TrkA_N" amino acids 131 to 245 (115 residues), 118.2 bits, see alignment E=3.8e-38 PF02080: TrkA_C" amino acids 280 to 350 (71 residues), 46.6 bits, see alignment E=4e-16

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1606)

Predicted SEED Role

"Potassium channel protein" in subsystem Potassium homeostasis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BM9 at UniProt or InterPro

Protein Sequence (350 amino acids)

>DVU1606 potassium uptake protein, TrkA family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTTMRGRLPLSTRIYRLRNRFGSVWPLLIGQVSLLCVFICATLGYMYIEGWSAFDSFYMV
VITLSTIGFGEVHPLSSQGRLLTTLVVFAGVGNFAFIIGAFSQLLVDGKLYRYMGRRRVL
KAIAKLRDHCIVCGYGRIGSVVAKELMEEGVALVVIENDPAMIEALETEGILHLAGDATN
DELLQAAGIERARALVAALSLDSANVYVVLSAHQINPSMTIVARASEPSHIGKLKLAGAD
RVFLPHHLGGLRMAQSILRPTVTSFIELAHTRSDLSIQMEELEIGDDSVLVGKTLIESGI
RPQYNLIIIGVKRPDGTMHFNPESTYTLQARDTLIAVGFPENFKQFQEIL