Protein Info for DVU1602 in Desulfovibrio vulgaris Hildenborough JW710

Name: clpA
Annotation: ATP-dependent Clp protease, ATP-binding subunit ClpA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 776 TIGR02639: ATP-dependent Clp protease ATP-binding subunit ClpA" amino acids 3 to 734 (732 residues), 1152 bits, see alignment E=0 PF02861: Clp_N" amino acids 4 to 126 (123 residues), 72.7 bits, see alignment E=2.2e-23 PF00004: AAA" amino acids 208 to 339 (132 residues), 49.5 bits, see alignment E=4.1e-16 amino acids 489 to 604 (116 residues), 45.6 bits, see alignment E=6.3e-15 PF17871: AAA_lid_9" amino acids 347 to 450 (104 residues), 96.8 bits, see alignment E=4.4e-31 PF07724: AAA_2" amino acids 483 to 646 (164 residues), 196.1 bits, see alignment E=2.9e-61 PF07728: AAA_5" amino acids 488 to 605 (118 residues), 51.3 bits, see alignment E=8.4e-17 PF10431: ClpB_D2-small" amino acids 653 to 733 (81 residues), 91.2 bits, see alignment E=2.3e-29

Best Hits

KEGG orthology group: K03694, ATP-dependent Clp protease ATP-binding subunit ClpA (inferred from 100% identity to dvu:DVU1602)

Predicted SEED Role

"ATP-dependent Clp protease ATP-binding subunit ClpA" in subsystem Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BN3 at UniProt or InterPro

Protein Sequence (776 amino acids)

>DVU1602 ATP-dependent Clp protease, ATP-binding subunit ClpA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIGKRLQAALNAAVGEVRVRNHEYLTLEHLLYAIAGEEQGKGILEGCGADVTALRARLEE
FFGTHLESLPEDMTTEVVQTLGVQRVLQRAFRHIQSAGRPLVEIGDVLAALFDEDDTYAV
YFLKTQGVSRLDVLEYISHAMPEADDDAMDGDDEGDGGASTRADALAQYATDLTARAREG
RIDPLIGREDELERTVQVLSRRRKNNPLFVGDPGVGKTAIAEGLALRIAVGAVPESFRKA
RVYALDMGSLLAGTKYRGDFEARLKAVISELSRQPDAILFIDEIHTIVGAGATSGGSMDA
SNILKPVLASGAIRCIGSTTHEEYRNHFEKDRALSRRFQKIDIGEPTQEECVEILKGLKE
HYEEHHAVRYTLPALRAAVELSARYVNDRLLPDKAIDVIDEAGAAMRLRAGFKPGASVSV
QDVERVVARMAHVPPRSISSSDRDRLKTLENDLGKAVFGQEAAVAVVARSILRARAGFGR
EDRPTGSFLFYGPTGVGKTELARSLAKRLGVAFLRYDMSEYMEKHAVSRFIGAPPGYVGY
DQGGQLTEAVRRTPYAVVLLDEMEKAHPDIFNVLLQVMDYATLTDNTGRKADFRNVVLIM
TSNAGVREMSAPSIGFTGGGVEDVTAKGRKAVETLFSPEFRNRLDALVPFGSLAPEVMER
IVDKFVREVENGLRERRVRLELTAAARQRLAEKGFDPAFGARPLRRVIRTAIEDELAKEM
LFGRLRKGGTVHVDALPQAPKTAGVAGQGGATPDAASLGLQFSYRERGEGSAEPAA