Protein Info for DVU1596 in Desulfovibrio vulgaris Hildenborough JW710

Name: cheB-1
Annotation: protein-glutamate methylesterase CheB (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 PF00072: Response_reg" amino acids 7 to 109 (103 residues), 78.7 bits, see alignment E=3.7e-26 PF01339: CheB_methylest" amino acids 172 to 349 (178 residues), 218.3 bits, see alignment E=6.1e-69

Best Hits

Swiss-Prot: 100% identical to CHEB1_DESVH: Protein-glutamate methylesterase/protein-glutamine glutaminase 1 (cheB1) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03412, two-component system, chemotaxis family, response regulator CheB [EC: 3.1.1.61] (inferred from 100% identity to dvl:Dvul_1538)

Predicted SEED Role

"Chemotaxis response regulator protein-glutamate methylesterase CheB (EC 3.1.1.61)" in subsystem Bacterial Chemotaxis (EC 3.1.1.61)

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.61

Use Curated BLAST to search for 3.1.1.61

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See P62636 at UniProt or InterPro

Protein Sequence (357 amino acids)

>DVU1596 protein-glutamate methylesterase CheB (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MARPCRVLIVDDSALVRQTLADLLSADPGIEVVGTASDPFVAAKRMEAVVPDVILLDIEM
PRMDGLTFLRKIMTQHPLPVVICSSVTEQGAEATFKAMEYGAVEVITKPRLGTKRFLEES
SIRICDAVKAAARARLHRLGHRTRDVAPKLTADAMLPGPTNFTRVQTTEKVVVVGASTGG
TEALQVFLEAMPPDAPPIAIVQHMPEHFTGAFSRRLDGICRIRVREAEDGDIMARGQALI
APGSSHMLLKRNGSRYTVEVKDGPLVRRHRPSVDVLFRSAARYAGANAVAAILTGMGDDG
AAGMKELHDMGAHTIAQDEATCIVFGMPHEAIRLGGVDRVLPLDAIAPAVLKACAGS