Protein Info for DVU1583 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: TPR domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 562 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF13432: TPR_16" amino acids 56 to 112 (57 residues), 19.8 bits, see alignment 9.8e-07 amino acids 117 to 166 (50 residues), 19.5 bits, see alignment 1.2e-06 amino acids 186 to 247 (62 residues), 32.5 bits, see alignment E=1.1e-10 amino acids 386 to 448 (63 residues), 34.7 bits, see alignment E=2.1e-11 amino acids 436 to 484 (49 residues), 17.7 bits, see alignment 4.4e-06 amino acids 490 to 552 (63 residues), 23.7 bits, see alignment E=5.9e-08 PF14559: TPR_19" amino acids 89 to 149 (61 residues), 34.8 bits, see alignment E=1.9e-11 amino acids 128 to 189 (62 residues), 31.2 bits, see alignment E=2.6e-10 amino acids 191 to 241 (51 residues), 26.2 bits, see alignment 9.1e-09 amino acids 228 to 276 (49 residues), 29.5 bits, see alignment 8.5e-10 PF13428: TPR_14" amino acids 115 to 156 (42 residues), 27.2 bits, see alignment 4.2e-09 amino acids 215 to 256 (42 residues), 27.2 bits, see alignment 4.1e-09 PF13174: TPR_6" amino acids 117 to 145 (29 residues), 13.8 bits, see alignment (E = 8.4e-05) PF13181: TPR_8" amino acids 215 to 246 (32 residues), 12.9 bits, see alignment (E = 0.00012) amino acids 417 to 448 (32 residues), 12.1 bits, see alignment (E = 0.00022) amino acids 520 to 551 (32 residues), 19.8 bits, see alignment (E = 7e-07) PF13176: TPR_7" amino acids 216 to 249 (34 residues), 19.3 bits, see alignment (E = 9.7e-07)

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1550)

Predicted SEED Role

"TPR domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BQ1 at UniProt or InterPro

Protein Sequence (562 amino acids)

>DVU1583 TPR domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPSFRRSVAAVVTALPLIAGGCAHRPAVETASPEAVQWNLSDGAETTFYYLMLDQAARSD
NTRDAIEAIENLIRLSPTARVYNDSGSFLLSRKEPDLARDILTRGVAAHPDDLGLTLLLA
ESYLDLDRNDEAIALLRAYNAKHPKDDEARQELAQLLVKTRRYEEADKLILSIGETSRTS
LLRYYHARALMGLNRLTEATAQLRKAVKASPDFLEAWAELAYVYELRKNYVEAEKIYEQI
LALDEGNQDVWLRLVAINIKLNNPVKAYELARQGPETFGFMLTAATLFLDDRFFEQAEGL
LLAVKDSPGAPEEVYFFLAVLAYEGQRDTDATLSWLLEVRPTNKYYDRALRLRSQLLYEK
GDLEAALRTAREGRETFPEQRDFREMEAQLLVNMGRSEEALRVIDKAADRWPDDSGLLFM
RALILDDRGAKDAAFAAMEEVIKASPNHAQALNYVGYTLAEQERDLTRAVSLLERANTLS
PDNPFILDSLAWAYFKAGRIPEAWKAISRAIELNAPDPIIWEHYGDIATAMGQKNTARRA
YRKALSMNPQNPDAIKAKLDKK