Protein Info for DVU1544 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: mechanosensitive ion channel family protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 807 signal peptide" amino acids 1 to 34 (34 residues), see Phobius details transmembrane" amino acids 261 to 280 (20 residues), see Phobius details amino acids 301 to 320 (20 residues), see Phobius details amino acids 326 to 348 (23 residues), see Phobius details amino acids 360 to 378 (19 residues), see Phobius details amino acids 384 to 400 (17 residues), see Phobius details amino acids 412 to 434 (23 residues), see Phobius details amino acids 440 to 463 (24 residues), see Phobius details amino acids 475 to 505 (31 residues), see Phobius details amino acids 533 to 555 (23 residues), see Phobius details amino acids 576 to 596 (21 residues), see Phobius details amino acids 600 to 629 (30 residues), see Phobius details PF00924: MS_channel_2nd" amino acids 616 to 683 (68 residues), 69.3 bits, see alignment E=2.5e-23 PF21082: MS_channel_3rd" amino acids 692 to 773 (82 residues), 66 bits, see alignment E=3.4e-22

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1544)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BU0 at UniProt or InterPro

Protein Sequence (807 amino acids)

>DVU1544 mechanosensitive ion channel family protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQKHHHSPLRISLASLATLLLLIALLMPGIARADDETQPPAEIPTSDAWGLIWQDRTQEL
VSLLEESEALRKDLPATARKLDADISGAQREYQRLFALFQASRSLPSELVAINGHLLALE
RGLQKSLSPLQTIHEGLEAKFGELESAEKELVAQLPRDRSDLAAELTTYLNNLSQGKRKL
ASLRSRLSGVIEPGKVLLGRIATTRRQIETMLPDLWRRHYLEPSSNLFDVGTWNGLQMSV
ETFIQNAPLRLATEMPTTPKVWIGCALRFLFIFVPVLIFGRMLARRETLRQALPDNRWKR
LTNRSMVWIGIGLALHFASWNSGEVFRAIVVPANIFLIWGQLTLAWELRALHRPGSPRRS
PFQPLFAPVLASLLLLFLNPPLVLLGPVWSLVLLIALWHSRKRQRHGTIPPLEANMVLIE
PFMLWLSLLVTLFGWGRLAILLYMAYLAIAVSLQLGLALMRLLDDASARLPREGASAILG
GVILGIAAPLVLLLVAGALVLWVIAYPGGSYILRHAIEFNFKVGEVSFDGLRILFILTAF
YVTRSLVAVGSTFLVRLPQRMHRFDRSMVQPMQTAFTYLLWALFGLYVLNALGVSLTNLA
VIAGGLSVGIGFGLQTIVNNFISGLILIFGRTLQEGDIIDLGGTMGTVRKVSIRATTVET
FDNAVIFVPNADLVSNRLTNWTRNSLTIRRDVAVGVAYGSDVELVTRLLLEVAKAHKRVL
HHPGPVVLFDNFGPSSLDFILRVWVDDIAVGVSTASDLRVEIDRVFRENNVEISFPQLDL
HVRSAEGLQPLTPGATTPTAPSASGEA