Protein Info for DVU1540 in Desulfovibrio vulgaris Hildenborough JW710

Name: purU
Annotation: formyltetrahydrofolate deformylase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00655: formyltetrahydrofolate deformylase
  • amino acids 6 to 283 (278 residues), 358.2 bits, E=1.8e-111
• PF00551: Formyl_trans_N
  • amino acids 89 to 265 (177 residues), 144 bits, E=2.1e-46

Best Hits

Swiss-Prot: 50% identical to PURU_BACSU: Formyltetrahydrofolate deformylase (purU) from Bacillus subtilis (strain 168)

KEGG orthology group: K01433, formyltetrahydrofolate deformylase [EC: 3.5.1.10] (inferred from 100% identity to dvl:Dvul_1591)

Predicted SEED Role

"Formyltetrahydrofolate deformylase (EC 3.5.1.10)" in subsystem One-carbon metabolism by tetrahydropterines (EC 3.5.1.10)

MetaCyc Pathways

• formaldehyde oxidation VII (THF pathway) (4/4 steps found)
• purine nucleobases degradation II (anaerobic) (16/24 steps found)
• folate transformations I (7/13 steps found)
• purine nucleobases degradation I (anaerobic) (5/15 steps found)

KEGG Metabolic Maps

• Glyoxylate and dicarboxylate metabolism
• One carbon pool by folate

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.1.10

Sequence Analysis Tools

See Q72BU4 at UniProt or InterPro

Protein Sequence (284 amino acids)

>DVU1540 formyltetrahydrofolate deformylase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MPSAYILTIACPDRIGIVATVSTFLAVQQCNIIDSAQFGDPDTRRFFLRIHFEMPDDGPG
RPELERLFAGVAATFDMQWELHDAGRKSRLMIMVSRFGHCLNDLLFRCSTGTLQAEITAI
VSNHADFERIAEMHGIPFHHLPVTKDTKREQEAAVAQVIEDTRSDVVVLARYMQVLSAEF
CSRYPGRIINIHHSFLPSFKGASPYHQAYARGVKLIGATAHYVTENLDEGPIIEQEVSRV
DHAHLPDALVNVGRDVESLVLSRAVRYHVEHRVLLNGHRTVVFR