Protein Info for DVU1536 in Desulfovibrio vulgaris Hildenborough JW710

Name: mltC
Annotation: transglycosylase, SLT family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 378 signal peptide" amino acids 1 to 31 (31 residues), see Phobius details PF01464: SLT" amino acids 217 to 335 (119 residues), 80.9 bits, see alignment E=2.7e-27

Best Hits

KEGG orthology group: K08306, membrane-bound lytic murein transglycosylase C [EC: 3.2.1.-] (inferred from 100% identity to dvl:Dvul_1595)

Predicted SEED Role

"Membrane-bound lytic murein transglycosylase C precursor (EC 3.2.1.-)" (EC 3.2.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 3.2.1.-

Use Curated BLAST to search for 3.2.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BU8 at UniProt or InterPro

Protein Sequence (378 amino acids)

>DVU1536 transglycosylase, SLT family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MHMNIRHRKACVRASLVTSAVAAVLGLVMGFVPEQGTNSVRRSLDRSVLRVAADAAPVPV
PHDSDTGWQWRGEVDSSAGANTTRRDVRPMAGDGLVRFENGGVLVATVDGGRVLSPAMSQ
GSLNDVSPVLGMDGSRLSPLLAVAVPEQYGEPLDVAGRPVRWLVSAEEYASRLGRECRQP
RSPSIGGVMRINRRAFAGGGDVSGLAGVYKAQVERFARKFGVRSRLVYAIMHAESGFDPA
ALSHASAHGLMQVVPGTAGEEVSAFLARRGESPADVDLFDPEDNIRYGIAYLHLLLNRHF
ADIRQPNSRELCAIAAYNGGPTRVLRVFGADRAQAVDAINALRPQQVYERLIRFLPAAES
RAYVDKVLASLESFSDVR