Protein Info for DVU1535 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 173 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 37 to 57 (21 residues), see Phobius details amino acids 69 to 88 (20 residues), see Phobius details amino acids 107 to 125 (19 residues), see Phobius details amino acids 145 to 168 (24 residues), see Phobius details PF04143: Sulf_transp" amino acids 34 to 166 (133 residues), 56.2 bits, see alignment E=2.1e-19

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 100% identity to dvu:DVU1535)

Predicted SEED Role

"membrane protein, putative"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BU9 at UniProt or InterPro

Protein Sequence (173 amino acids)

>DVU1535 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLINGLVTGVLFGILLQRAEVLRYDRQLGALRLQDMTIIKFMLSAIIVSMVGIHALVDLE
LAKLSVKPLVLGANIGGGLLFGLGWGILGYCPGTAAGALGEGRLDALWGIMGGLAGAAAY
AELYPAMKATLLSMGDVGKVTLPQLLGLGHWPVIVIFIVVVVAVMRLVERKGL