Protein Info for DVU1534 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 170 transmembrane" amino acids 9 to 31 (23 residues), see Phobius details amino acids 68 to 87 (20 residues), see Phobius details amino acids 107 to 128 (22 residues), see Phobius details amino acids 143 to 166 (24 residues), see Phobius details PF04143: Sulf_transp" amino acids 5 to 159 (155 residues), 80.9 bits, see alignment E=6.6e-27

Best Hits

KEGG orthology group: K07112, (no description) (inferred from 99% identity to dvl:Dvul_1597)

Predicted SEED Role

"FIG00605460: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BV0 at UniProt or InterPro

Protein Sequence (170 amino acids)

>DVU1534 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSDSGRWNPYVAGGLSGLVMVGSVALSNAYFGASTTFVRMAGMIEKAFAPEHVAGLAYFT
KEAPIVDWQWMFVVGILLGAFVAAMLSGTYRVQAVPDMWRERFGTSAGLRGVAAFVGGFL
ALFGARLAGGCPSGHGLSGVAQLAGSGLVSLVCFFVGGLIVARLLYGGRR