Protein Info for DVU1502 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: portal protein, HK97 family (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 419 transmembrane" amino acids 52 to 72 (21 residues), see Phobius details TIGR01537: phage portal protein, HK97 family" amino acids 45 to 402 (358 residues), 250 bits, see alignment E=1.8e-78 PF04860: Phage_portal" amino acids 53 to 396 (344 residues), 346.3 bits, see alignment E=8.7e-108

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1502)

Predicted SEED Role

"Phage portal protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72BY2 at UniProt or InterPro

Protein Sequence (419 amino acids)

>DVU1502 portal protein, HK97 family (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGWLDRILGRKEVSPKNAASLNLADADSWFETFGGSRVASGVIVNESTAMRFSAVFACVR
LIGGAIASAPVKIYRRRRDDGREIAPGHTIASMLRVRPNRFMTAATFWRFLAQSKVLQGN
AYAHVIRTRSGDPVALYPIDPRNVAIYWAWELGLDKLPGVERNRLFYRVTWEDGAQSMID
QDDMLHIPNVGWDGKRGLSTISAAAQGIGLGLAAEKSSAAFFANGMQSAFALQYPAKMTP
EAVEMIRAHISERYAGAHNHHKPLVLTEGGEAKQLSMTADDAQLIQSRQFSVIDICRFFG
VPPVMVGETEKTSSWGAGVEQMARWFTTFTLNDHLTAFEQELEVKIFRGDGHFAEFDESE
LTRGDTKTRGEYYRTARGSMQEPGFMTVNEIRSAEGLPPIAGGDTMQRPAETRGGKADA