Protein Info for DVU1470 in Desulfovibrio vulgaris Hildenborough JW710

Name: ppiC
Annotation: peptidyl-prolyl cis-trans isomerase C (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13145: Rotamase_2
  • amino acids 11 to 91 (81 residues), 32.2 bits, E=2.6e-11
• PF00639: Rotamase
  • amino acids 14 to 89 (76 residues), 73.3 bits, E=4e-24
• PF13616: Rotamase_3
  • amino acids 14 to 91 (78 residues), 71 bits, E=1.8e-23

Best Hits

Swiss-Prot: 52% identical to PPIC_ECOL6: Peptidyl-prolyl cis-trans isomerase C (ppiC) from Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC)

KEGG orthology group: K03769, peptidyl-prolyl cis-trans isomerase C [EC: 5.2.1.8] (inferred from 100% identity to dvu:DVU1470)

MetaCyc: 52% identical to peptidyl-prolyl cis-trans isomerase C (Escherichia coli K-12 substr. MG1655)
Peptidylprolyl isomerase. [EC: 5.2.1.8]

Predicted SEED Role

"Peptidyl-prolyl cis-trans isomerase PpiC (EC 5.2.1.8)" (EC 5.2.1.8)

Isozymes

Compare fitness of predicted isozymes for: 5.2.1.8

Use Curated BLAST to search for 5.2.1.8

Sequence Analysis Tools

See Q72C14 at UniProt or InterPro

Protein Sequence (94 amino acids)

>DVU1470 peptidyl-prolyl cis-trans isomerase C (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MLKARARHILVPTEEACNELKTRIEGGEDFAEVARASSRCPSGKRGGDLGEFPRGAMVPE
FDEAVFTGEVGKVLGPIRTQFGYHLVEVTSRSGE