Protein Info for DVU1469 in Desulfovibrio vulgaris Hildenborough JW710

Name: rpsA
Annotation: ribosomal protein S1, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 PF00575: S1" amino acids 32 to 96 (65 residues), 27.9 bits, see alignment E=6.2e-10 amino acids 118 to 181 (64 residues), 25.8 bits, see alignment E=2.9e-09 amino acids 200 to 261 (62 residues), 68.8 bits, see alignment E=1e-22 amino acids 289 to 362 (74 residues), 72.1 bits, see alignment E=1e-23 PF23459: S1_RRP5" amino acids 199 to 259 (61 residues), 31.4 bits, see alignment E=5.9e-11 amino acids 289 to 361 (73 residues), 30.6 bits, see alignment E=1e-10

Best Hits

KEGG orthology group: K02945, small subunit ribosomal protein S1 (inferred from 100% identity to dvu:DVU1469)

Predicted SEED Role

"SSU ribosomal protein S1p" in subsystem Ribosome SSU bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C15 at UniProt or InterPro

Protein Sequence (487 amino acids)

>DVU1469 ribosomal protein S1, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTGEPIDTPELDESASFAELLEAHAGGTRNVRPGDRISAAIVAITDDSVFVATGSKVDGV
IDRRELEEADGSLPYAVGDRVDLYVTAVNGQEIRLSKGLSGQGGAAVLEEARDSGVPVEG
RVTGTCKGGYNVDVLRKRAFCPGSQIDLHQLEDAESVVGQTFQFLVTRVEQHGRNIVVSR
RALLERERDAALATFLEGVKEGDVLEGTVTRLAPFGAFVEIAPGVDGMVHISELTWSRVA
QADEAVSVGDRVRVKVLGIGEAPKGKGTRISLSVKQAGGDPWETVGDRLEQDQVVPAKVV
RLAPFGAFVEVLPGVEGLVHVSEMSWTRRVNKPEEIVAVGDAVNVKIKELDVAKRRISLS
LRDAEGDPWADATERFAPGTQVTGTVEKRAQFGLFVNIAPGLTGLLPEGIIKSSGQGASL
SKLNAGDSVTLTVRDISAETRRITLAPVGDAGHGGDDGSWKQFAPRKEKPQLGSLGAALQ
AAMQKRK