Protein Info for DVU1467 in Desulfovibrio vulgaris Hildenborough JW710

Name: hslU
Annotation: heat shock protein HslVU, ATPase subunit HslU (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 441 TIGR00390: ATP-dependent protease HslVU, ATPase subunit" amino acids 4 to 441 (438 residues), 632.9 bits, see alignment E=1.5e-194 PF07728: AAA_5" amino acids 52 to 88 (37 residues), 22.4 bits, see alignment 1.6e-08 PF00004: AAA" amino acids 53 to 107 (55 residues), 27.5 bits, see alignment 5.7e-10 amino acids 233 to 330 (98 residues), 27 bits, see alignment E=8.3e-10 PF07724: AAA_2" amino acids 198 to 326 (129 residues), 82.6 bits, see alignment E=5.2e-27

Best Hits

Swiss-Prot: 100% identical to HSLU_DESVH: ATP-dependent protease ATPase subunit HslU (hslU) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03667, ATP-dependent HslUV protease ATP-binding subunit HslU (inferred from 100% identity to dvl:Dvul_1612)

MetaCyc: 54% identical to ATPase component of the HslVU protease (Escherichia coli K-12 substr. MG1655)

Predicted SEED Role

"ATP-dependent hsl protease ATP-binding subunit HslU" in subsystem Proteasome bacterial or Proteolysis in bacteria, ATP-dependent

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C17 at UniProt or InterPro

Protein Sequence (441 amino acids)

>DVU1467 heat shock protein HslVU, ATPase subunit HslU (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSTLTPREIVSELDRFVVGQEKAKRMVAVAMRNRWRRQRLEPSLRDEVAPKNIIMMGPTG
VGKTEIARRLARLCGAPFIKVEATKYTEVGYVGRDVESMVRDLMEIGVSLIRDEEATRVR
ARAEAAAEERLLDLLLPQSPADGGETRQSTRDKLRGLWRQGHLDDREVDMEVEESTKGPQ
MDIFAMPGMESMGNQFRDLMGKAFPARRKMRKMKLREAWNLLVDEEASRLLDQDKVVDIA
RERVEQTGIIFIDELDKVASGEGTHRTTDISREGVQRDLLPIVEGSVVNTKYGMVRTDHI
LFIAAGAFHFSKPSDLIPELQGRFPLRVELDPLGRDEFYRILTEPHNALTRQYAALLATE
GVTVSFTDDGLREIAAFAEEVNEETENIGARRLYTMMERILADISFDAPDRPGEHVTVDA
AYVRTHLEDVRVDKDLSRYIL