Protein Info for DVU1461 in Desulfovibrio vulgaris Hildenborough JW710

Name: hemA
Annotation: glutamyl-tRNA reductase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 440 TIGR01035: glutamyl-tRNA reductase" amino acids 5 to 420 (416 residues), 460.4 bits, see alignment E=2.9e-142 PF05201: GlutR_N" amino acids 8 to 156 (149 residues), 163.7 bits, see alignment E=5.4e-52 PF01488: Shikimate_DH" amino acids 171 to 306 (136 residues), 166 bits, see alignment E=1e-52 PF03807: F420_oxidored" amino acids 187 to 262 (76 residues), 25.2 bits, see alignment E=4.1e-09 PF00745: GlutR_dimer" amino acids 320 to 420 (101 residues), 94 bits, see alignment E=1.3e-30

Best Hits

Swiss-Prot: 100% identical to HEM1_DESVH: Glutamyl-tRNA reductase (hemA) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K02492, glutamyl-tRNA reductase [EC: 1.2.1.70] (inferred from 100% identity to dvu:DVU1461)

Predicted SEED Role

"Glutamyl-tRNA reductase (EC 1.2.1.70)" in subsystem Experimental tye or Heme and Siroheme Biosynthesis (EC 1.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.70

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C23 at UniProt or InterPro

Protein Sequence (440 amino acids)

>DVU1461 glutamyl-tRNA reductase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MERDIYLIGLNHRTAGVEVRERFALTDCNVLEQGVVPIDDVVSEVLILSTCNRVEILAVG
RGPEVVSRVLRGWSAARGQCEHDLAPYVYTHKGPEAIRHLFRVASSLDSMVVGEPQILGQ
LKDAYRKAIERNCTRVILNRLLHKAFSVAKRVRTETGVASSAVSISYAAVELAKRIFGEM
NQYKAMLIGAGEMAELAATHLLHAGISKIYVANRTFERGRELARQFNGEAIHFEDLFERL
ADADIIISSTGAHEAIIRARDIKDVLRRRKHRPMFFIDIAVPRDIDPDVNNLDNVYLYDI
DDLKEVVEENLAQRREEASKALTIVEEETGKFGQWLRSLELQPTIVDLIRRSERIAQDEL
ARTLKRLGPVDDETRDALEAMLSSMVRKLNHEPITFLKRRHSEEDAGPRYIDIARRMFNL
DDDNVPPDAHCDRRRHDEDN