Protein Info for DVU1444 in Desulfovibrio vulgaris Hildenborough JW710

Name: flgD
Annotation: basal-body rod modification protein FlgD (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 265 PF03963: FlgD" amino acids 16 to 76 (61 residues), 80.7 bits, see alignment E=1.1e-26 PF13861: FLgD_tudor" amino acids 85 to 219 (135 residues), 55.1 bits, see alignment E=1e-18 PF13860: FlgD_ig" amino acids 102 to 179 (78 residues), 70.6 bits, see alignment E=1.3e-23

Best Hits

KEGG orthology group: K02389, flagellar basal-body rod modification protein FlgD (inferred from 100% identity to dvl:Dvul_1635)

Predicted SEED Role

"Flagellar basal-body rod modification protein FlgD" in subsystem Flagellar motility or Flagellum

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C40 at UniProt or InterPro

Protein Sequence (265 amino acids)

>DVU1444 basal-body rod modification protein FlgD (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MGTSVNNILGQAENEFQSAVKKSGNADLGKDAFLQLLVTQLKHQDPLNPMDDKEFVAQLA
QFTSLEQLMGINTGVTSMNEAFKQQQMMNAVSYIGKDVLASGDQISKIKDGVSKLYFSID
EPITQGVINIFNASNELVRSEFISAKQAGDYEYVWDGKDYQGNAMADGLYKVAMAAENDK
GKAVLVSTEVSGHVIGVETINGTQYLRMQDGRSVQFMNVSVVVAPSTGSGSGSDSGSGGG
SDSGSGSDSGSGSDSGSGSDSGSGT