Protein Info for DVU1440 in Desulfovibrio vulgaris Hildenborough JW710

Name: rnc
Annotation: ribonuclease III (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 253 signal peptide" amino acids 1 to 18 (18 residues), see Phobius details TIGR02191: ribonuclease III" amino acids 32 to 250 (219 residues), 234.2 bits, see alignment E=6.2e-74 PF14622: Ribonucleas_3_3" amino acids 42 to 168 (127 residues), 130.4 bits, see alignment E=7e-42 PF00636: Ribonuclease_3" amino acids 67 to 157 (91 residues), 88.2 bits, see alignment E=8.7e-29 PF00035: dsrm" amino acids 185 to 251 (67 residues), 43.8 bits, see alignment E=4.8e-15

Best Hits

Swiss-Prot: 100% identical to RNC_DESVH: Ribonuclease 3 (rnc) from Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / DSM 644 / NCIMB 8303)

KEGG orthology group: K03685, ribonuclease III [EC: 3.1.26.3] (inferred from 100% identity to dvu:DVU1440)

Predicted SEED Role

"Ribonuclease III (EC 3.1.26.3)" in subsystem RNA processing and degradation, bacterial or Two cell division clusters relating to chromosome partitioning (EC 3.1.26.3)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.26.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C44 at UniProt or InterPro

Protein Sequence (253 amino acids)

>DVU1440 ribonuclease III (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MWARTAAWVFGLPETLREICYRRDNVKPVDELQKTIGHRFGDMELLLTAMTHSSWANEQA
VPVEHNERLEFLGDAVLELCVSEELFRRFPSAREGDLTRMRSRLVSKPSLEGVARELRLD
MSLRLGKGEESQGGRERGSLLSDALEAMLGAVFLDAGYIAAKGVVMRILGPHFPEALVPV
RTKDYKSQLQELTQKLFRDRPVYTLLGSSGPEHDKQFDVRVVLPDGTVFEATGPSMKRAE
QMAAARAVATLDK