Protein Info for DVU1429 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: GTP-binding protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 366 TIGR00092: GTP-binding protein YchF" amino acids 1 to 366 (366 residues), 482.8 bits, see alignment E=3.6e-149 PF02421: FeoB_N" amino acids 5 to 50 (46 residues), 32.9 bits, see alignment 6.7e-12 PF01926: MMR_HSR1" amino acids 5 to 122 (118 residues), 79.1 bits, see alignment E=4.2e-26 PF06071: YchF-GTPase_C" amino acids 282 to 365 (84 residues), 133 bits, see alignment E=5.2e-43

Best Hits

Swiss-Prot: 54% identical to YCHF_BACSU: Ribosome-binding ATPase YchF (ychF) from Bacillus subtilis (strain 168)

KEGG orthology group: K06942, (no description) (inferred from 100% identity to dvl:Dvul_1647)

Predicted SEED Role

"GTP-binding and nucleic acid-binding protein YchF" in subsystem Universal GTPases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C55 at UniProt or InterPro

Protein Sequence (366 amino acids)

>DVU1429 GTP-binding protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MALSIGIVGLPNVGKSTLFNALTKAQNAEAANYPFCTIEPNKATVAVPDKRLDALAEIVK
PQRVLHATVDFIDIAGLVRGASKGEGLGNQFLANIRECAAILEVVRCFDDENITHVDGAI
DPLRDIETIETELLLADIQSAEKRFERLQKMAKGDKDAKAAAEEVARLLEHMNAGNPAST
FEARESDAFQLAWREMGLLTAKKIIYCANVDETGIGEENAHVLRVRELAASRGADVVKIC
AKIEEELQGLSDEEQAEMLGSYGIDESGLVSIIRTGYHTLGLASYFTAGEKEVRAWTIKQ
GWKAPQGAGVIHTDFERGFIRAEVIAYDDYVKHRSEAACRSAGVLRVEGKEYVMQDGDVV
HFLFNV