Protein Info for DVU1428 in Desulfovibrio vulgaris Hildenborough JW710

Name: pgm
Annotation: phosphoglucomutase, alpha-D-glucose phosphate-specific (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01132: phosphoglucomutase, alpha-D-glucose phosphate-specific
  • amino acids 1 to 544 (544 residues), 861.4 bits, E=1.2e-263
• PF02878: PGM_PMM_I
  • amino acids 40 to 180 (141 residues), 108.5 bits, E=4.6e-35
• PF02879: PGM_PMM_II
  • amino acids 211 to 318 (108 residues), 53 bits, E=9.1e-18
• PF02880: PGM_PMM_III
  • amino acids 321 to 440 (120 residues), 99 bits, E=3.8e-32
• PF00408: PGM_PMM_IV
  • amino acids 491 to 540 (50 residues), 34.2 bits, 4.3e-12

Best Hits

Swiss-Prot: 59% identical to PGM_KOMXY: Phosphoglucomutase (celB) from Komagataeibacter xylinus

KEGG orthology group: K01835, phosphoglucomutase [EC: 5.4.2.2] (inferred from 100% identity to dvu:DVU1428)

MetaCyc: 60% identical to phosphoglucomutase (Yersinia enterocolitica (type O:8))
Phosphoglucomutase. [EC: 5.4.2.2]

Predicted SEED Role

"Phosphoglucomutase (EC 5.4.2.2)" (EC 5.4.2.2)

MetaCyc Pathways

• O-antigen building blocks biosynthesis (E. coli) (10/11 steps found)
• colanic acid building blocks biosynthesis (10/11 steps found)
• dTDP-β-L-rhamnose biosynthesis (5/5 steps found)
• superpathway of anaerobic sucrose degradation (15/19 steps found)
• UDP-α-D-glucose biosynthesis (2/2 steps found)
• sucrose biosynthesis I (from photosynthesis) (7/9 steps found)
• glycogen degradation I (6/8 steps found)
• sucrose biosynthesis II (6/8 steps found)
• glycogen biosynthesis I (from ADP-D-Glucose) (3/4 steps found)
• starch degradation V (3/4 steps found)
• GDP-α-D-glucose biosynthesis (2/3 steps found)
• trehalose degradation V (2/3 steps found)
• glycogen degradation II (4/6 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• CDP-6-deoxy-D-gulose biosynthesis (3/5 steps found)
• glucose and glucose-1-phosphate degradation (3/5 steps found)
• sucrose degradation II (sucrose synthase) (3/5 steps found)
• starch degradation III (2/4 steps found)
• sucrose degradation IV (sucrose phosphorylase) (2/4 steps found)
• chitin biosynthesis (5/9 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• glucosylglycerol biosynthesis (2/5 steps found)
• starch biosynthesis (5/10 steps found)
• glycogen biosynthesis III (from α-maltose 1-phosphate) (2/8 steps found)
• superpathway of dTDP-glucose-derived O-antigen building blocks biosynthesis (5/19 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (13/33 steps found)
• streptomycin biosynthesis (2/18 steps found)

KEGG Metabolic Maps

• Galactose metabolism
• Glycolysis / Gluconeogenesis
• Nucleotide sugars metabolism
• Pentose phosphate pathway
• Starch and sucrose metabolism
• Streptomycin biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 5.4.2.2

Sequence Analysis Tools

See Q72C56 at UniProt or InterPro

Protein Sequence (551 amino acids)

>DVU1428 phosphoglucomutase, alpha-D-glucose phosphate-specific (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MSVHPLAGERPSHDRLVNIPALMGEYYTGHPDTTAVERRVAFGTSGHRGSSLHGTFNEEH
ILAVTQAVCDIRREDGIAGPLFLGMDTHALSECAHRTALEVLAANGVNVRLQTGGGFTPT
PVISHAILCWNAHRDRPRADGVVITPSHNPPEDGGFKYNPPHGGPADTTVTRRIERRANE
LLDNGLAGVRRVVLHKALRTPGIEAVDLVSAYVNDLASVLDMDAIRGAGLRIAADPLGGS
SLAYWDPIAEKYGLDITVVNREADPTFRFMPQDKDGKVRMDCSSPWAMRGLIDLRQSYDI
AFGNDPDADRHGIVTAQGLLNPNHYIAAAVWYLYRHRPGWNTTCGIGKTLVTSSMVDRVA
KLLGRKVVEVPVGFKWFVPLLLDGSCGFGGEESAGASFLRSDGTPWSTDKDGIIMNLLAA
EMMAVEERSPSEIYAELTERCGTPYYERLQSPATAAQRAVFAGLTPERVKATSLAGAPIT
AMLTHAPGNGAAIGGLKVVTDDGWFAARPSGTEDMYKIYTESFVSPEHLQRIQKDAVDIV
ASIFADADASS