Protein Info for DVU1424 in Desulfovibrio vulgaris Hildenborough JW710

Name: gcvPB
Annotation: glycine cleavage system P protein, subunit 2 (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 481 PF00266: Aminotran_5" amino acids 148 to 271 (124 residues), 26.6 bits, see alignment E=3.1e-10 PF21478: GcvP2_C" amino acids 348 to 447 (100 residues), 77 bits, see alignment E=1.2e-25

Best Hits

Swiss-Prot: 61% identical to GCSPB_CALS4: Probable glycine dehydrogenase (decarboxylating) subunit 2 (gcvPB) from Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4)

KEGG orthology group: K00283, glycine dehydrogenase subunit 2 [EC: 1.4.4.2] (inferred from 100% identity to dvu:DVU1424)

Predicted SEED Role

"Glycine dehydrogenase [decarboxylating] (glycine cleavage system P2 protein) (EC 1.4.4.2)" in subsystem Glycine and Serine Utilization or Glycine cleavage system or Photorespiration (oxidative C2 cycle) (EC 1.4.4.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.4.4.2

Use Curated BLAST to search for 1.4.4.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C60 at UniProt or InterPro

Protein Sequence (481 amino acids)

>DVU1424 glycine cleavage system P protein, subunit 2 (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKTVFAKSVPGRSAALPSAPSRKAADMLPAGLLRSKAPRLPEVSELDVVRHFTGLSRLNY
SVDGNFYPLGSCTMKYNPKFTEHVAALPGFTRLHPLMAQLKGAGQYTQGALEVMWETERL
LCEINGMAAFTLHPMAGAHGELTGVMLIAAYHKDKGNRKTKIICPDSAHGTNPASAALAG
YEVVNIESKDGLVDPDALEAVLDDEVAALMMTCPNTLGLFEKHLPRIVEKLRAVDALLYY
DGANLNAIMGKMRVGDVGFDVVHLNLHKTFGTPHGGGGPGSGPVGVSARLEPYLPISRVE
KERDGHFFLNYDYPKSIGYVAPFYGNFGVLLKAYAYILRLGAEGLTRASEFAVLNANYMR
CKLRGVLDIPHDRTCMHEFVASACNTAECGVRALDIAKALLDKGYHAPTIYFPLIVKECL
MFEPTETESRETLDAFMDDLASIVEQGRQTPDALHDAPLHTPVRRLDETAAARNMVLTDD
L