Protein Info for DVU1423 in Desulfovibrio vulgaris Hildenborough JW710

Name: lpdA
Annotation: 2-oxoglutarate dehydrogenase, E3 component, lipoamide dehydrogenase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07992: Pyr_redox_2
  • amino acids 3 to 319 (317 residues), 190.8 bits, E=1.8e-59
• PF01134: GIDA
  • amino acids 4 to 142 (139 residues), 24.2 bits, E=8.6e-09
• PF00890: FAD_binding_2
  • amino acids 4 to 40 (37 residues), 28 bits, 6.6e-10
• PF00070: Pyr_redox
  • amino acids 173 to 250 (78 residues), 60.8 bits, E=7.7e-20
• PF02852: Pyr_redox_dim
  • amino acids 342 to 448 (107 residues), 57.3 bits, E=8.6e-19

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to dvu:DVU1423)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

• glycine biosynthesis II (3/3 steps found)
• glycine cleavage (3/3 steps found)
• 2-oxoglutarate decarboxylation to succinyl-CoA (1/3 steps found)
• 2-oxoisovalerate decarboxylation to isobutanoyl-CoA (1/3 steps found)
• pyruvate decarboxylation to acetyl CoA I (1/3 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (14/22 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glycine, serine and threonine metabolism
• Glycolysis / Gluconeogenesis
• Pyruvate metabolism
• Valine, leucine and isoleucine degradation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

See Q72C61 at UniProt or InterPro

Protein Sequence (456 amino acids)

>DVU1423 2-oxoglutarate dehydrogenase, E3 component, lipoamide dehydrogenase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTYDVVILGAGPGGSRAALEAAAAGLRVAIVDKGSFGGTCLNWGCIPTKLLLGGTAAHPL
LEVQKKLKTAQGTIDFDLTALQARKTRFINGTRQALEKQLRQAGIEVITGTARLAGPGHV
EVVDGEGTRELAARNVIVATGSVPASFPGLAPDGEAVLDSTALLDVTEVPDSLIIVGGGA
IGLEMGDFFSRLGTAITIVEGLDRLAPTEDPEIGQTLGKLLKREGWAIHTGRRVASLSTV
EGKAQLRFEDGTELVADKALMAVGRRPATAGLGLETAGATLLGAGWVETNDHLLAAPGLY
AIGDVNGRTLLAHAADHQARFVISHIASGSASSASGYPAPVMPSCIYGHTEVMRAGATVA
ELVASGHDVHVSTSQLIANPIAQAYGTTGGFIRVLWVEGQVRGISAVGHGVSHLVTLATV
IVSQRWRWEDVHGIIFAHPTLDEALEAALLAPSQKV