Protein Info for DVU1423 in Desulfovibrio vulgaris Hildenborough JW710

Name: lpdA
Annotation: 2-oxoglutarate dehydrogenase, E3 component, lipoamide dehydrogenase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 456 PF07992: Pyr_redox_2" amino acids 3 to 319 (317 residues), 190.8 bits, see alignment E=1.8e-59 PF01134: GIDA" amino acids 4 to 142 (139 residues), 24.2 bits, see alignment E=8.6e-09 PF00890: FAD_binding_2" amino acids 4 to 40 (37 residues), 28 bits, see alignment 6.6e-10 PF00070: Pyr_redox" amino acids 173 to 250 (78 residues), 60.8 bits, see alignment E=7.7e-20 PF02852: Pyr_redox_dim" amino acids 342 to 448 (107 residues), 57.3 bits, see alignment E=8.6e-19

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 100% identity to dvu:DVU1423)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C61 at UniProt or InterPro

Protein Sequence (456 amino acids)

>DVU1423 2-oxoglutarate dehydrogenase, E3 component, lipoamide dehydrogenase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTYDVVILGAGPGGSRAALEAAAAGLRVAIVDKGSFGGTCLNWGCIPTKLLLGGTAAHPL
LEVQKKLKTAQGTIDFDLTALQARKTRFINGTRQALEKQLRQAGIEVITGTARLAGPGHV
EVVDGEGTRELAARNVIVATGSVPASFPGLAPDGEAVLDSTALLDVTEVPDSLIIVGGGA
IGLEMGDFFSRLGTAITIVEGLDRLAPTEDPEIGQTLGKLLKREGWAIHTGRRVASLSTV
EGKAQLRFEDGTELVADKALMAVGRRPATAGLGLETAGATLLGAGWVETNDHLLAAPGLY
AIGDVNGRTLLAHAADHQARFVISHIASGSASSASGYPAPVMPSCIYGHTEVMRAGATVA
ELVASGHDVHVSTSQLIANPIAQAYGTTGGFIRVLWVEGQVRGISAVGHGVSHLVTLATV
IVSQRWRWEDVHGIIFAHPTLDEALEAALLAPSQKV