Protein Info for DVU1419 in Desulfovibrio vulgaris Hildenborough JW710

Name: atoC
Annotation: sigma-54 dependent transcriptional regulator/response regulator (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 459 PF00072: Response_reg" amino acids 5 to 113 (109 residues), 99.5 bits, see alignment E=5.1e-32 PF00158: Sigma54_activat" amino acids 142 to 308 (167 residues), 236.9 bits, see alignment E=4.1e-74 PF14532: Sigma54_activ_2" amino acids 143 to 313 (171 residues), 65.3 bits, see alignment E=3e-21 PF00004: AAA" amino acids 166 to 284 (119 residues), 21.9 bits, see alignment E=8.1e-08 PF07728: AAA_5" amino acids 166 to 285 (120 residues), 36.6 bits, see alignment E=1.8e-12 PF25601: AAA_lid_14" amino acids 314 to 395 (82 residues), 80.4 bits, see alignment E=2.9e-26 PF02954: HTH_8" amino acids 413 to 453 (41 residues), 49.8 bits, see alignment 9.4e-17

Best Hits

Swiss-Prot: 42% identical to DCTD_RHIME: C4-dicarboxylate transport transcriptional regulatory protein DctD (dctD) from Rhizobium meliloti (strain 1021)

KEGG orthology group: K02481, two-component system, NtrC family, response regulator (inferred from 100% identity to dvu:DVU1419)

Predicted SEED Role

"Response regulator of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C65 at UniProt or InterPro

Protein Sequence (459 amino acids)

>DVU1419 sigma-54 dependent transcriptional regulator/response regulator (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MKHLLVIDDEPGHRLMVRAVMEDVGWHVVEAGSGEEGLELLVHEQVHVVLLDMRMPGMDG
QETLARILEIQPGLPVVMLTAYGTVGSAVEAMKCGAFDYLTKPADNEELVAVLEKAWEHR
RLVVENEELRKRYVENDPTAPLVGASQVMHRMRDFIRQAGPSEATVLIMGESGTGKELIA
QALHDASTRARQPLVKVNCAALPGHLLESELFGYVRGAFTGAVKDKPGRFQLARGGTLFL
DEIGELPLELQAKLLRVLQERVVEPLGGVRPVSVDVRIIAATNRDLRREVAKGTFREDLY
FRLNVLEVVSPPLRKRMEDLPQLVEELLGKLCRKNRKSIRCISADFFEALSRHSWPGNVR
ELENVLERALILSRTDSLSADALPPQLFGDEPQVADMQQERPVVDDDSRPCSLDEAEKGE
LLRALDVHGGHREKTADALGISRRTLQYKLKKFGLTRRA