Protein Info for DVU1418 in Desulfovibrio vulgaris Hildenborough JW710

Name: hydH
Annotation: sensory box histidine kinase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 579 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 188 to 210 (23 residues), see Phobius details TIGR00229: PAS domain S-box protein" amino acids 227 to 342 (116 residues), 24.7 bits, see alignment E=1.1e-09 PF08448: PAS_4" amino acids 230 to 335 (106 residues), 37.3 bits, see alignment E=5.5e-13 PF00512: HisKA" amino acids 351 to 414 (64 residues), 53.7 bits, see alignment E=3.5e-18 PF02518: HATPase_c" amino acids 457 to 563 (107 residues), 77.2 bits, see alignment E=2.7e-25

Best Hits

KEGG orthology group: K00936, [EC: 2.7.3.-] (inferred from 100% identity to dvu:DVU1418)

Predicted SEED Role

"Sensor protein of zinc sigma-54-dependent two-component system" in subsystem Zinc resistance

Isozymes

Compare fitness of predicted isozymes for: 2.7.3.-

Use Curated BLAST to search for 2.7.3.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C66 at UniProt or InterPro

Protein Sequence (579 amino acids)

>DVU1418 sensory box histidine kinase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MEIADKNAERSTIIIAVLTLVTIGLSLIVTTGQTLRQQEEAGTQYLTMTSRSVLQAVESS
LRRGLFVRPTGPGLFSPGTAEFFRELEQTGDVLFVGVIDRNGGRVLSSRPAQEAGPLAFP
PEALQQLAQKGEWYGRATFGARQTYVYGKRIVPGRGLAQDEDELPTFLVVGLDMTKHLGV
YNRFRQNALFQAAYILAAAVFIWTLAMSFLKRREQAGRAAVLERFQARLLDNLPDGLITV
SRSDTISAANPAAHGILGIAPGRLAGMSIAELPEGIVAPVARVAEGGSSAEPEAAAGRWF
TRSVGGAHLEVLTLPIRQGDDDHDRLVIIRDRTQIRELEKNLSEAEKLAALGTLAAGVAH
EIRNPLSALRGFAQYFAKKLVGRQPDETYAQTMVREADRLNRVITDLLYLSRPRAMDARA
VSLGQLVADIGNLVRFDLEKRNIALKVSLGPDIVWADEDALKQAVLNLVLNSIDALEGLA
TGEREIHVSSAQGDGGTWVFVGDSGPGMSALQREQAFEPFFTTKKKGTGLGLALVHKTMR
EHDGRAQIDSEMGRGTTVSLFFPGNEGVVPCSPDVEVRK