Protein Info for DVU1414 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: sensory box/GGDEF domain/EAL domain protein (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 800 850 900 950 997 signal peptide" amino acids 1 to 28 (28 residues), see Phobius details transmembrane" amino acids 172 to 190 (19 residues), see Phobius details amino acids 265 to 277 (13 residues), see Phobius details PF17203: sCache_3_2" amino acids 33 to 168 (136 residues), 49.3 bits, see alignment E=2.6e-16 PF00672: HAMP" amino acids 189 to 238 (50 residues), 37.2 bits, see alignment 1.4e-12 TIGR00229: PAS domain S-box protein" amino acids 325 to 386 (62 residues), 25.2 bits, see alignment 1.5e-09 amino acids 427 to 552 (126 residues), 46.5 bits, see alignment E=3.8e-16 PF00989: PAS" amino acids 431 to 542 (112 residues), 27.5 bits, see alignment E=1.2e-09 PF13426: PAS_9" amino acids 441 to 543 (103 residues), 29.1 bits, see alignment E=4.5e-10 TIGR00254: diguanylate cyclase (GGDEF) domain" amino acids 552 to 717 (166 residues), 152.3 bits, see alignment E=1e-48 PF00990: GGDEF" amino acids 556 to 713 (158 residues), 166.6 bits, see alignment E=1.8e-52 PF00563: EAL" amino acids 735 to 968 (234 residues), 246.6 bits, see alignment E=1.1e-76

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvu:DVU1414)

Predicted SEED Role

"sensory box/GGDEF domain/EAL domain protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C70 at UniProt or InterPro

Protein Sequence (997 amino acids)

>DVU1414 sensory box/GGDEF domain/EAL domain protein (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MIRSRLFRRTLLGMLVLFGFYALAVSAGSDIFTRRQLMRESEATARAVAQSIAGSSMDSL
YGLDPITIQSRIDQYLSVPGVRYALVTASSGDIVAHTFAPVVPEDVRALARSLSDARKAD
STFQQYDVDLPDGSAALHCVMPVYEGLGGYVHIGMDRSSLDSHVGHVVRSQQILALVFFC
VAAFASWFFLQSISRPLAALTDYARKVAAHEFPAPVEVKSRDEIGTLARVMGFMAADLAR
FVGGLEAEVKRSTGELRTALGELSAIVGGMGEGLLVVSAEGLVLRSNEAFASLFCLEPFG
CPVALDALLPLSGQDDSGLRGVLEDALQSMARGEAARHSGEYPFICGDGVRRWVGCTIEP
VTIGGKPCIVCLVQDVTARNEAQQALRDAYDKLEAEVASRTRDLRRANAQLLLENAERRS
VEQALRRAEQRYRGIFENAVEGIFQIAPDGMLLRGNPAMAEMFGYSDIESLREVGSMAEA
MFAEATSSDVFFHQLEMTGNVSGFEFRARHREDRELWLRVNARRVADAHDATLFYEGFLT
DITISHRSRQQLAHQAYHDPLTGLPNRLLFLDHLQLAMQRAARRTDAMFTVLYLDLDRFK
IINDSLGHGIGDALLREVACTLRRCVRDVDTVARFGGDEFAILLEDTGNCAGAVRIARRI
RESLAQPVNIAGHEVFTTASIGIVLQTRDYLTPEDILRDADTAMYRAKEMGKSRFKVFNA
RMREDTLRLMALETDLRFAVERGELSLRYHPIVDLEDGSLHGFESLLRWRRGNEDVSPAE
FIPVAEDAGLIADIGAFVIEDVCRQVAAWQDTACDCGIVHVNISGRQLMRPGFAQMVDEI
LRRHGIAGSCLRFEVTESVLVRHGTLAVSVMHQLRELGIRLCLDDFGTGYSSLGYLRRLP
VESLKIDRSFVWGMEKDEAGRALVRGILTLGLHLGLEVVAEGVETEEQAVLLRDMGCRYG
QGFLYAKPLLSERVPPFVCLREAAVAGYGVSVSTGVA