Protein Info for DVU1386 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: membrane protein, putative (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 516 transmembrane" amino acids 6 to 25 (20 residues), see Phobius details amino acids 46 to 68 (23 residues), see Phobius details amino acids 82 to 102 (21 residues), see Phobius details amino acids 121 to 144 (24 residues), see Phobius details amino acids 164 to 182 (19 residues), see Phobius details amino acids 231 to 252 (22 residues), see Phobius details amino acids 272 to 298 (27 residues), see Phobius details amino acids 318 to 341 (24 residues), see Phobius details amino acids 361 to 380 (20 residues), see Phobius details amino acids 391 to 410 (20 residues), see Phobius details amino acids 416 to 434 (19 residues), see Phobius details amino acids 446 to 467 (22 residues), see Phobius details amino acids 487 to 509 (23 residues), see Phobius details

Best Hits

KEGG orthology group: K07027, (no description) (inferred from 100% identity to dvl:Dvul_1685)

Predicted SEED Role

"FIG00605705: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72C98 at UniProt or InterPro

Protein Sequence (516 amino acids)

>DVU1386 membrane protein, putative (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MNRHLRSLGSFVVLCIFAGAAWLLYHEVRKYHLADIRQSIELIPDLRLLASFGLMIVNYL
ILVGYDALALKAIGRPLPLGKTALVSFVGCACSYNFGALLGGSSVRYRFYSAWGFTIPDV
VRLVLMLAVTFWVGALGLAGLSFVIEPLPLPPGLGLPIDDVRPLGFALLAATTGYLLLTF
FVRKPLHFFGREFALPCPKIAFAQTLTACADLVAAAGCLYMLMPSDLGLDFLTFLAVYLL
ATVVVVLTHVPGGAGVFELVILSLSQTTHPQAVIAALLAFRVIYYLLPLLFAALLLAGYE
VQVRRHQAEKAFRDAGRWMWVLSHILLSYVTFAAGVILLLSGSIPPNKLLIAQSPLVVPP
AVQEAAHILGSMAGAGLLLLSRGIERRLASVWKVVVTLLLTGMVCALLKGFDWHEAVLLS
FALAGLLGSRRRFYRKSSLIREEYPLRWFFASAAVIGCAGAVALFAFGDAGTGIRGLWEA
ISDDAGAARAVRGIAAACAVMVAFTLRRLLLPLHKQ