Protein Info for DVU1371 in Desulfovibrio vulgaris Hildenborough JW710

Annotation: HAD-superfamily hydrolase, subfamily IA (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 224 PF00702: Hydrolase" amino acids 16 to 188 (173 residues), 68.4 bits, see alignment E=1.8e-22 PF13419: HAD_2" amino acids 19 to 193 (175 residues), 90.6 bits, see alignment E=2.1e-29 TIGR01549: HAD hydrolase, family IA, variant 1" amino acids 111 to 188 (78 residues), 25.8 bits, see alignment E=1.2e-09 PF13242: Hydrolase_like" amino acids 149 to 195 (47 residues), 23.4 bits, see alignment 7e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to dvl:Dvul_1697)

Predicted SEED Role

"HAD-superfamily hydrolase, subfamily IA, variant 1"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CB2 at UniProt or InterPro

Protein Sequence (224 amino acids)

>DVU1371 HAD-superfamily hydrolase, subfamily IA (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MQGIRYGLDRHFPEGIRGIVFDCDGVLFDSRASNIHYYNLLLDALGLPRMTPSQEDYVHM
HTVGESLNHIVPTDYRDRLPEARSRIRYRQHILPLLEPEPGLRETLWWLRDAGVKLAVHT
NRTDSMEYVLDHFGMTDFFFPVMTAGRVRAKPHPEGLHVILRSWGVAPSSIVFIGDTRLD
EETARAAGVPFWAYRSPTLTAQVHVTDYWSLSQTLRGVLARDCD