Protein Info for DVU1363 in Desulfovibrio vulgaris Hildenborough JW710

Name: rfbD
Annotation: dTDP-4-dehydrorhamnose reductase (TIGR)

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 291 signal peptide" amino acids 1 to 25 (25 residues), see Phobius details TIGR01214: dTDP-4-dehydrorhamnose reductase" amino acids 8 to 282 (275 residues), 259.4 bits, see alignment E=1.8e-81 PF04321: RmlD_sub_bind" amino acids 8 to 283 (276 residues), 273.5 bits, see alignment E=3.7e-85 PF01370: Epimerase" amino acids 10 to 217 (208 residues), 69.1 bits, see alignment E=7.9e-23 PF02719: Polysacc_synt_2" amino acids 41 to 146 (106 residues), 22.6 bits, see alignment E=1.2e-08

Best Hits

Swiss-Prot: 33% identical to RMLD_SINFN: dTDP-4-dehydrorhamnose reductase (NGR_a03570) from Sinorhizobium fredii (strain NBRC 101917 / NGR234)

KEGG orthology group: K00067, dTDP-4-dehydrorhamnose reductase [EC: 1.1.1.133] (inferred from 99% identity to dvl:Dvul_1705)

Predicted SEED Role

"dTDP-4-dehydrorhamnose reductase (EC 1.1.1.133)" in subsystem Rhamnose containing glycans or dTDP-rhamnose synthesis or linker unit-arabinogalactan synthesis (EC 1.1.1.133)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.133

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q72CC0 at UniProt or InterPro

Protein Sequence (291 amino acids)

>DVU1363 dTDP-4-dehydrorhamnose reductase (TIGR) (Desulfovibrio vulgaris Hildenborough JW710)
MTARPRAVVLGGRTGLLGQSLVLALRNGGWDAVPVGRDDVDVLDAERLADFIDKASPQAV
FNTVAWTQVDLAEEHEQEAAQLNRALPASLGRIVRGTGMHLVHLSTDFVFNGRKTTPYST
DDTPDPASVYGATKLAGETALLSIAPDNCCVVRTAWLFGPGRRNFVQTILGLCAAKDDIQ
VVHDQTGSPTYTVDLAAGCVRLAELRATGLFHVVNAGQASWCELASEAVHLAGLHCKVHA
ITSKDWPQKAARPAYSVLDTSRFTEVTGIVPRPWPQALRDYIYKDCIPSGN